Tnfrsf12a (TNF receptor superfamily member 12A)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tnfrsf12a (TNF receptor superfamily member 12A) Rattus norvegicus

Analyze

Symbol:

Tnfrsf12a

Name:

TNF receptor superfamily member 12A

RGD ID:

631329

Description:

Predicted to be involved in positive regulation of extrinsic apoptotic signaling pathway; regulation of angiogenesis; and regulation of wound healing. Predicted to act upstream of or within extrinsic apoptotic signaling pathway; positive regulation of axon extension; and substrate-dependent cell migration, cell attachment to substrate. Predicted to be located in cell surface; plasma membrane; and ruffle. Orthologous to human TNFRSF12A (TNF receptor superfamily member 12A); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Fn14; MGC72653; tumor necrosis factor receptor superfamily member 12A; tumor necrosis factor receptor superfamily, member 12a

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	12,707,077 - 12,709,071 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	12,689,890 - 12,709,045 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	17,450,479 - 17,452,451 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	16,939,272 - 16,941,244 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	12,439,729 - 12,441,702 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	12,995,904 - 12,997,930 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	12,995,904 - 12,997,930 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	12,818,949 - 12,820,975 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	12,940,334 - 12,942,343 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	12,940,333 - 12,942,343 (-)	NCBI
Celera	10	12,402,383 - 12,404,393 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

epilepsy (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

idiopathic generalized epilepsy (ISO)

myocardial infarction (ISO)

short-rib thoracic dysplasia 9 with or without polydactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-citrinin (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-bromo-2'-deoxyuridine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antimycin A (ISO)

arachidonic acid (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chloropicrin (ISO)

choline (ISO)

chromium(6+) (ISO)

ciglitazone (EXP)

cisplatin (ISO)

clofibric acid (EXP)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

curcumin (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

dichloroacetic acid (ISO)

dimethyl sulfoxide (EXP)

dioxygen (EXP,ISO)

diquat (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

elemental selenium (ISO)

Enterolactone (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

etoposide (ISO)

fenamidone (ISO)

fipronil (EXP)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (EXP,ISO)

furan (EXP,ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

hydroquinone (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

irinotecan (EXP)

iron dichloride (ISO)

isoprenaline (ISO)

L-methionine (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

lipopolysaccharide (EXP)

manganese(II) chloride (ISO)

mechlorethamine (ISO)

melamine (EXP)

menadione (ISO)

mercury dichloride (EXP)

metacetamol (ISO)

methamphetamine (EXP)

methapyrilene (EXP)

methimazole (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

methylmercury(1+) (EXP)

microcystin-LR (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-N-nitrosourea (EXP)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

naphthalene (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

ochratoxin A (ISO)

ofloxacin (EXP)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (EXP,ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentanal (ISO)

pentane-2,3-dione (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP,ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

phosgene (ISO)

potassium chromate (ISO)

progesterone (ISO)

propiconazole (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

ranitidine (EXP)

rotenone (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

Soman (EXP)

succimer (ISO)

sulfadimethoxine (EXP)

sulforaphane (EXP)

sunitinib (ISO)

T-2 toxin (EXP,ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

torcetrapib (ISO)

triacsin C (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

Triptolide (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell adhesion (ISO)

extrinsic apoptotic signaling pathway (ISO)

positive regulation of apoptotic process (ISO)

positive regulation of axon extension (ISO)

positive regulation of extrinsic apoptotic signaling pathway (IBA,ISO)

regulation of angiogenesis (ISO)

regulation of wound healing (ISO)

substrate-dependent cell migration, cell attachment to substrate (ISO)

Cellular Component

cell surface (ISO)

plasma membrane (IBA,ISO)

ruffle (ISO)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Pro-inflammatory effect of TWEAK/Fn14 interaction on human umbilical vein endothelial cells.	Harada N, etal., Biochem Biophys Res Commun 2002 Dec 6;299(3):488-93.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10551889	PMID:11728344	PMID:12477932	PMID:12821115	PMID:14573547	PMID:16762976	PMID:19629561	PMID:20082609	PMID:21525013	PMID:22555979	PMID:23873135	PMID:24571920
PMID:29249219	PMID:31610210	PMID:34047412

Genomics

Comparative Map Data

Tnfrsf12a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	12,707,077 - 12,709,071 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	12,689,890 - 12,709,045 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	17,450,479 - 17,452,451 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	16,939,272 - 16,941,244 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	12,439,729 - 12,441,702 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	12,995,904 - 12,997,930 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	12,995,904 - 12,997,930 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	12,818,949 - 12,820,975 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	12,940,334 - 12,942,343 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	12,940,333 - 12,942,343 (-)	NCBI
Celera	10	12,402,383 - 12,404,393 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

TNFRSF12A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	3,020,368 - 3,022,383 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	3,018,445 - 3,022,383 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	3,070,369 - 3,072,384 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	3,010,361 - 3,012,385 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	3,010,360 - 3,012,382	NCBI
Celera	16	3,275,870 - 3,277,940 (+)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	3,042,784 - 3,043,958 (+)	NCBI		HuRef
CHM1_1	16	3,070,187 - 3,072,258 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	3,046,940 - 3,048,955 (+)	NCBI		T2T-CHM13v2.0

Tnfrsf12a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	23,894,419 - 23,896,423 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	23,894,419 - 23,896,442 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	23,675,445 - 23,677,449 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	23,675,445 - 23,677,468 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	23,812,412 - 23,814,416 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	23,403,067 - 23,405,066 (-)	NCBI		MGSCv36	mm8
Celera	17	24,181,651 - 24,183,653 (-)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	11.99	NCBI

Tnfrsf12a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	14,320,159 - 14,322,146 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	14,320,159 - 14,322,146 (-)	NCBI	ChiLan1.0	ChiLan1.0

TNFRSF12A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	7,343,507 - 7,345,554 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	1,962,179 - 1,964,223 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	3,134,577 - 3,136,581 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	3,134,577 - 3,136,581 (+)	Ensembl	panpan1.1		panPan2

TNFRSF12A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	38,166,160 - 38,168,189 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	38,166,160 - 38,168,189 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	39,406,703 - 39,408,732 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	38,476,762 - 38,478,791 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	38,476,762 - 38,478,906 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	38,162,557 - 38,164,586 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	38,135,059 - 38,137,088 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	38,610,821 - 38,612,857 (-)	NCBI		UU_Cfam_GSD_1.0

Tnfrsf12a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	105,558,357 - 105,560,277 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936694	1,149,076 - 1,151,151 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936694	1,149,169 - 1,151,098 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFRSF12A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	39,166,298 - 39,168,302 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	39,166,288 - 39,168,294 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	40,531,414 - 40,533,682 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFRSF12A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	2,763,633 - 2,765,692 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	2,763,714 - 2,765,137 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	28,066,705 - 28,068,765 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Tnfrsf12a
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	365
Count of miRNA genes:	201
Interacting mature miRNAs:	221
Transcripts:	ENSRNOT00000004842
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat

Markers in Region

RH129279

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	12,707,219 - 12,707,410 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	12,996,042 - 12,996,232	NCBI	Rnor6.0
Rnor_5.0	10	12,819,087 - 12,819,277	UniSTS	Rnor5.0
RGSC_v3.4	10	12,940,472 - 12,940,662	UniSTS	RGSC3.4
Celera	10	12,402,521 - 12,402,711	UniSTS
Cytogenetic Map	10	q12	UniSTS

BI281199

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	12,706,630 - 12,706,795 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	12,995,453 - 12,995,617	NCBI	Rnor6.0
Rnor_5.0	10	12,818,498 - 12,818,662	UniSTS	Rnor5.0
RGSC_v3.4	10	12,939,883 - 12,940,047	UniSTS	RGSC3.4
Celera	10	12,401,932 - 12,402,096	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1	36	10	2		2	4	5		24	27	7	4
Low	2	7	47	39	19	39	4	6	74	11	14	4	4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_181086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY255102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229590	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000004842 ⟹ ENSRNOP00000004843

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	12,707,077 - 12,709,045 (-)	Ensembl
Rnor_6.0 Ensembl	10	12,995,904 - 12,997,930 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107526 ⟹ ENSRNOP00000080282

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	12,689,890 - 12,709,026 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116910 ⟹ ENSRNOP00000097829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	12,689,890 - 12,709,026 (-)	Ensembl

RefSeq Acc Id:

NM_181086 ⟹ NP_851600

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	12,707,082 - 12,709,055 (-)	NCBI
Rnor_6.0	10	12,995,904 - 12,997,930 (-)	NCBI
Rnor_5.0	10	12,818,949 - 12,820,975 (-)	NCBI
RGSC_v3.4	10	12,940,334 - 12,942,343 (-)	RGD
Celera	10	12,402,383 - 12,404,393 (-)	RGD

Sequence:

show sequence

AGACCGTTCTTGCCTCTGAACCGGCAATCATGGCTCCGGGTTGGCCGCGGCCTCTGCCGCAGCT
CCTCGTGTTGGGATTCGGGTTGGTGTTGATACGCGCCACGGCCGGGGAGCAAGCACCAGGCAAC
GCCCCATGCTCAAGCGGCAGCTCCTGGAGCGCGGACCTCGACAAGTGCATGGACTGCGCTTCTT
GTCCAGCGCGACCACACAGCGACTTCTGCCTGGGATGCGCAGCAGCACCTCCTGCCCACTTCAG
GATGCTATGGCCCATTCTGGGAGGCGCTCTTAGTCTGGCCCTGGTTTTGGCGCTGGTTTCTGGT
TTCCTGGTCTGGAGACGATGCCGCCGGAGAGAAAAGTTTACTACCCCCATAGAGGAGACTGGTG
GAGAAGGCTGCCCAGGTGTGGCACTGATCCAGTGAGGAGCACCCGCGCTGGTGCCCATTCATCG
TCCATTCATTCATTCTGGAGCCAGCCTGGCTTTCCAGAGACAAGCCGCGCCAGACTCTTCCAAC
CACAAGGGGGTGGGGCGAGGTGGTGATTCACCTCCAAGGACTGGGCTTAGGGTTCAGGGGAGCC
TTCCAGGGTGTCTAATTGCCCTGTCTCTGGTTCTGGGGCAGACAGAGAGCCTCAAGCTAGGTCA
CAAAGCGACTCATACTAAGGATCTGCAGCATTTGCACAAGGGAATCTCTTGCTCCCCACAAGTC
CTGGAGGCCTGGCCGACTTGAGGGGCAGACACAACACTGGGTTCCACCCACTCGGATGGACTGA
AATGCCACTACCCTGAGTTTTAGCCCTGGGAGTGGGTTAGATTGAGGGACCTGTTCATAACACT
AAGGGGGCTGGCCCTCTGGGAGGGCTGGTCCCAGTACACACAAACACAACCCATCCCCCAAGGG
GGTGATATTTATTTTGGGGATAAAGTTTGGAGGGGAGGGAGACTTATTAATAAAAGAATCTTTA
ACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085851 ⟹ XP_038941779

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	12,707,077 - 12,709,071 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_851600	(Get FASTA)	NCBI Sequence Viewer
	XP_038941779	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60537	(Get FASTA)	NCBI Sequence Viewer
	AAP06753	(Get FASTA)	NCBI Sequence Viewer
	EDM03764	(Get FASTA)	NCBI Sequence Viewer
	EDM03765	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004843.4
	ENSRNOP00000080282.1
	ENSRNOP00000097829.1

RefSeq Acc Id:	NP_851600 ⟸ NM_181086
- Peptide Label:	precursor
- UniProtKB:	Q80XX9 (UniProtKB/TrEMBL), A6HCK9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPGWPRPLPQLLVLGFGLVLIRATAGEQAPGNAPCSSGSSWSADLDKCMDCASCPARPHSDFC LGCAAAPPAHFRMLWPILGGALSLALVLALVSGFLVWRRCRRREKFTTPIEETGGEGCPGVALI Q hide sequence

RefSeq Acc Id:

ENSRNOP00000004843 ⟸ ENSRNOT00000004842

RefSeq Acc Id:	XP_038941779 ⟸ XM_039085851
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000080282 ⟸ ENSRNOT00000107526

RefSeq Acc Id:

ENSRNOP00000097829 ⟸ ENSRNOT00000116910

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6F9-F1-model_v2	AlphaFold	G3V6F9	1-129	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696993

Promoter ID:

EPDNEW_R7517

Type:

initiation region

Name:

Tnfrsf12a_1

Description:

TNF receptor superfamily member 12A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	12,997,930 - 12,997,990	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631329	AgrOrtholog
BioCyc Gene	G2FUF-25915	BioCyc
Ensembl Genes	ENSRNOG00000003546	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004842.6	UniProtKB/TrEMBL
	ENSRNOT00000107526.1	UniProtKB/TrEMBL
	ENSRNOT00000116910.1	UniProtKB/TrEMBL
Gene3D-CATH	4.10.400.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6887545	IMAGE-MGC_LOAD
InterPro	TNFR_12	UniProtKB/TrEMBL
KEGG Report	rno:302965	UniProtKB/TrEMBL
MGC_CLONE	MGC:72653	IMAGE-MGC_LOAD
NCBI Gene	302965	ENTREZGENE
PANTHER	PTHR32037	UniProtKB/TrEMBL
	TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER 12A	UniProtKB/TrEMBL
Pfam	stn_TNFRSF12A	UniProtKB/TrEMBL
PhenoGen	Tnfrsf12a	PhenoGen
PRINTS	TNFACTORR12	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003546	RatGTEx
UniProt	A0A8I5ZQC8_RAT	UniProtKB/TrEMBL
	A0A8I6AVJ2_RAT	UniProtKB/TrEMBL
	A6HCK9	ENTREZGENE, UniProtKB/TrEMBL
	A6HCL0_RAT	UniProtKB/TrEMBL
	G3V6F9_RAT	UniProtKB/TrEMBL
	Q80XX9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-05	Tnfrsf12a	TNF receptor superfamily member 12A	Tnfrsf12a	tumor necrosis factor receptor superfamily, member 12a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-11	Tnfrsf12a	tumor necrosis factor receptor superfamily, member 12a			Symbol and Name status set to approved	625702	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)