Advanced Search (OLGA)

Gene: Selenos (selenoprotein S) Rattus norvegicus

Analyze

Symbol:

Selenos

Name:

selenoprotein S

RGD ID:

628897

Description:

Predicted to enable ATPase binding activity; antioxidant activity; and ubiquitin-specific protease binding activity. Predicted to be involved in several processes, including intracellular signal transduction; negative regulation of apoptotic process; and negative regulation of cytokine production. Predicted to be located in cytoplasmic microtubule and endoplasmic reticulum membrane. Predicted to be part of endoplasmic reticulum membrane; low-density lipoprotein particle; and very-low-density lipoprotein particle. Orthologous to human SELENOS (selenoprotein S); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

Ratsg2; Sels; sg2; Tanis; VCP-interacting membrane protein; VCP-interacting membrane selenoprotein; Vimp

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SELENOS (selenoprotein S)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Selenos (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Selenos (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SELENOS (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SELENOS (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Selenos (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SELENOS (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SELENOS (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Selenos (selenoprotein S)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ALDH3A2 (aldehyde dehydrogenase 3 family member A2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Selenos (selenoprotein S)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SELENOS (selenoprotein S)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	selenos	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	selenos	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	129,070,240 - 129,080,007 (+)	NCBI		GRCr8
mRatBN7.2	1	119,659,779 - 119,669,546 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	119,659,751 - 119,669,833 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	127,652,801 - 127,662,498 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	134,824,245 - 134,833,942 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	127,633,662 - 127,643,427 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	126,979,579 - 126,989,344 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	126,979,575 - 126,989,344 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	128,065,929 - 128,075,694 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	120,509,100 - 120,518,867 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	120,587,444 - 120,597,210 (+)	NCBI
Celera	1	111,871,435 - 111,881,202 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colorectal adenoma (ISO)

colorectal carcinoma (ISO)

Inflammation (ISO)

lung non-small cell carcinoma (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic acid (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

cisplatin (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

coumarin (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

D-glucose (ISO)

dibenzo[a,l]pyrene (ISO)

dicrotophos (ISO)

dioxygen (ISO)

diuron (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

fenpyroximate (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

glafenine (EXP)

glucose (ISO)

isobutanol (ISO)

lycopene (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

parathion (ISO)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

pinostrobin (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

quercetin (ISO)

rotenone (ISO)

sertraline (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

T-2 toxin (ISO)

tacrolimus hydrate (ISO)

tamoxifen (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thalidomide (ISO)

thapsigargin (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell redox homeostasis (IEA,ISO)

cellular oxidant detoxification (IEA)

cellular response to lipopolysaccharide (IEA,ISO)

cellular response to oxidative stress (IEA,ISO)

endoplasmic reticulum unfolded protein response (IBA,IEA,ISO)

ER overload response (IEA,ISO)

ERAD pathway (IEA,ISO)

intracellular protein transport (IEA)

negative regulation of acute inflammatory response to antigenic stimulus (IEA,ISO)

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

negative regulation of interleukin-6 production (IEA,ISO)

negative regulation of macrophage apoptotic process (IEA,ISO)

negative regulation of tumor necrosis factor production (IEA,ISO)

regulation of nitric oxide metabolic process (IEA,ISO)

response to glucose (IEA,ISO)

response to redox state (IEA,ISO)

retrograde protein transport, ER to cytosol (IBA,IEA,ISO)

Cellular Component

cytoplasm (IEA)

cytoplasmic microtubule (IEA,ISO,ISS)

Derlin-1 retrotranslocation complex (IBA,IEA,ISO)

Derlin-1-VIMP complex (IBA,IEA,ISO)

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum membrane (IEA,ISO)

low-density lipoprotein particle (IEA,ISO)

membrane (IEA)

very-low-density lipoprotein particle (IEA,ISO)

Molecular Function

antioxidant activity (IEA,ISO)

ATPase binding (IEA,ISO)

enzyme binding (IEA,ISO)

protein binding (ISO)

ubiquitin-specific protease binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of Selenoprotein Genes and Association with Selenium Status in Colorectal Adenoma and Colorectal Cancer.	Hughes DJ, etal., Nutrients. 2018 Nov 21;10(11). pii: nu10111812. doi: 10.3390/nu10111812.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12031974	PMID:12775843	PMID:15063746	PMID:15215856	PMID:15489334	PMID:16227999	PMID:16574427	PMID:17000876	PMID:17210132	PMID:17374524	PMID:18675776	PMID:19966530
PMID:23264731	PMID:23404306	PMID:23614019	PMID:24424410	PMID:26058460	PMID:27645994

Genomics

Comparative Map Data

Selenos
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	129,070,240 - 129,080,007 (+)	NCBI		GRCr8
mRatBN7.2	1	119,659,779 - 119,669,546 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	119,659,751 - 119,669,833 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	127,652,801 - 127,662,498 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	134,824,245 - 134,833,942 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	127,633,662 - 127,643,427 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	126,979,579 - 126,989,344 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	126,979,575 - 126,989,344 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	128,065,929 - 128,075,694 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	120,509,100 - 120,518,867 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	120,587,444 - 120,597,210 (+)	NCBI
Celera	1	111,871,435 - 111,881,202 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

SELENOS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	101,270,809 - 101,277,485 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	101,270,531 - 101,277,500 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	101,811,014 - 101,817,690 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	99,628,737 - 99,635,223 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	78,224,059 - 78,230,545 (-)	NCBI		Celera
Cytogenetic Map	15	q26.3	NCBI
HuRef	15	77,933,623 - 77,940,109 (-)	NCBI		HuRef
CHM1_1	15	101,652,200 - 101,658,686 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	99,025,841 - 99,032,517 (-)	NCBI		T2T-CHM13v2.0

Selenos
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	65,729,397 - 65,739,153 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	65,729,397 - 65,739,153 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	66,079,649 - 66,089,405 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	66,079,649 - 66,089,405 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	73,224,535 - 73,234,291 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	65,958,609 - 65,968,353 (+)	NCBI		MGSCv36	mm8
Celera	7	63,515,279 - 63,525,171 (+)	NCBI		Celera
Cytogenetic Map	7	C	NCBI
cM Map	7	35.49	NCBI

Selenos
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	28,153,460 - 28,162,095 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	28,152,984 - 28,162,173 (-)	NCBI	ChiLan1.0	ChiLan1.0

SELENOS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	90,861,442 - 90,867,950 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	94,561,283 - 94,569,167 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	79,995,678 - 80,002,159 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	99,279,195 - 99,285,682 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	99,279,203 - 99,285,682 (-)	Ensembl	panpan1.1		panPan2

SELENOS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	39,796,711 - 39,805,654 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	39,796,711 - 39,805,591 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	42,486,298 - 42,495,243 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	40,188,127 - 40,197,076 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	40,188,094 - 40,197,506 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	39,721,571 - 39,730,515 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	39,958,383 - 39,967,333 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	40,159,929 - 40,168,876 (+)	NCBI		UU_Cfam_GSD_1.0

Selenos
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	143,733,962 - 143,744,737 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	2,589,828 - 2,599,987 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	2,589,773 - 2,600,837 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SELENOS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	139,828,791 - 139,836,914 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	139,829,002 - 139,836,923 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	156,058,088 - 156,066,010 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SELENOS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	19,727,073 - 19,732,384 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	19,726,451 - 19,732,375 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	26,808,486 - 26,813,835 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Selenos
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	3,539,465 - 3,550,211 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624768	3,539,369 - 3,550,716 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Selenos
101 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	326
Count of miRNA genes:	201
Interacting mature miRNAs:	217
Transcripts:	ENSRNOT00000016916
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
631569	Bp93	Blood pressure QTL 93		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	121834139	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF367467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016916 ⟹ ENSRNOP00000016916

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	119,659,751 - 119,669,833 (+)	Ensembl
Rnor_6.0 Ensembl	1	126,979,575 - 126,989,338 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081746 ⟹ ENSRNOP00000074863

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	119,659,751 - 119,667,530 (+)	Ensembl
Rnor_6.0 Ensembl	1	126,979,579 - 126,989,344 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116909 ⟹ ENSRNOP00000094148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	119,659,751 - 119,669,539 (+)	Ensembl

RefSeq Acc Id:

NM_173120 ⟹ NP_775143

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	129,070,240 - 129,080,007 (+)	NCBI
mRatBN7.2	1	119,659,779 - 119,669,546 (+)	NCBI
Rnor_6.0	1	126,979,579 - 126,989,344 (+)	NCBI
Rnor_5.0	1	128,065,929 - 128,075,694 (+)	NCBI
RGSC_v3.4	1	120,509,100 - 120,518,867 (+)	RGD
Celera	1	111,871,435 - 111,881,202 (+)	RGD

Sequence:

show sequence

GAAGGGCTAGTCGTTGGCGGCCGCAGCCATGGATCGCGGGGAGGAACCTCTGTCCGCGAGGCCG
GCGCTGGAGACCGAGAGCCTGCGATTCCTGCACGTCACAGTGGGCTCCCTGCTGGCCAGCTATG
GCTGGTACATCCTCTTCAGCTGCGTCCTTCTCTACATTGTCATCCAGAAGCTCTCCCTGCGACT
GAGGGCTTTAAGGCAGAGGCAGCTGGACCAAGCTGAGGCTGTTCTGGAGCCTGATGTTGTTGTT
AAGCGACAAGAGGCTTTAGCAGCTGCTCGTTTGAGAATGCAGGAAGATCTGAATGCCCAAGTTG
AAAAACATAAGGAAAAACTAAGACAGCTTGAAGAAGAGAAAAGGAGACAGAAGATTGAAATGTG
GGACAGCATGCAAGAAGGCAGAAGTTACAAAAGAAACTCAGGAAGGCCTCAGGAAGAAGATGGT
CCTGGACCTTCTACTTCATCGGTCATCCCCAAAGGAAAATCTGACAAAAAGCCTTTACGGGGAG
GTGGTTATAACCCTCTGACAGGTGAAGGGGGTGGAACCTGCTCCTGGAGACCTGGACGCAGGGG
CCCATCATCTGGTGGATGAAGCTAAGACTCTTGTTAGTGTCGCTTTGACATTAGCAAGGTGAAC
CCTTAACCCTCAACTCAATTGCCTTACGCACACTTTCACAGTGACTGGCCAAGGAGAGGTAGGG
CTGATTTCTGTTCTGAACACCTCATATTTTAAGGGCTTTGGTCATAGACATTGCCACTAGGCCA
CACTCTAGACGAGACAGCTATTGGTTTTGTGGCCACTTGCTAGTCAGTAGGTTGGAGGCTTCTT
GCTGTTTCTCAGACTTCATCGAGGAGGCCCAGTGATGGCCCTTTGGGGCAGAAGTCCTTGATGA
CAGACAGGGTGGTCTCTGTGACAGGATGCGTTGAATGATGTCTTCCTTATAAATGGTGAGCCCA
CCAGTGAGGATTACTGATGTACACAGTTGATGGGGTTTGCTTCTGTATATTTATTTTATGTACA
GAACTTTGTAAAAAAAAAAAAGTTAACTACTTAAAAAGTAACATTTTTAGCATCTTTATTAAAC
TCAAGGAAATTTCTTTGTGAGCTTGACTTTGTCAGACAGTAAACAGCTTTTTATCAGTAAAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_775143	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH59111	(Get FASTA)	NCBI Sequence Viewer
	AAL59556	(Get FASTA)	NCBI Sequence Viewer
	EDM08423	(Get FASTA)	NCBI Sequence Viewer
	EDM08424	(Get FASTA)	NCBI Sequence Viewer
	EDM08425	(Get FASTA)	NCBI Sequence Viewer
	EDM08426	(Get FASTA)	NCBI Sequence Viewer
	Q8VHV8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_775143 ⟸ NM_173120
- UniProtKB:	A0A8I6AMI0 (UniProtKB/TrEMBL), A6JBP7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDRGEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQRQLD QAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSY KRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUS hide sequence

Ensembl Acc Id:

ENSRNOP00000016916 ⟸ ENSRNOT00000016916

Ensembl Acc Id:

ENSRNOP00000074863 ⟸ ENSRNOT00000081746

Ensembl Acc Id:

ENSRNOP00000094148 ⟸ ENSRNOT00000116909

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690105

Promoter ID:

EPDNEW_R627

Type:

multiple initiation site

Name:

Selenos_1

Description:

selenoprotein S

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	126,979,575 - 126,979,635	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628897	AgrOrtholog
BioCyc Gene	G2FUF-59018	BioCyc
Ensembl Genes	ENSRNOG00000012576	Ensembl
Gene3D-CATH	6.10.250.2950	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6920258	IMAGE-MGC_LOAD
InterPro	Selenoprotein_S	UniProtKB/Swiss-Prot
KEGG Report	rno:286900	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72657	IMAGE-MGC_LOAD
NCBI Gene	286900	ENTREZGENE
PANTHER	PTHR28621	UniProtKB/Swiss-Prot
	SELENOPROTEIN S	UniProtKB/Swiss-Prot
Pfam	Selenoprotein_S	UniProtKB/Swiss-Prot
PhenoGen	Selenos	PhenoGen
RatGTEx	ENSRNOG00000012576	RatGTEx
UniProt	A0A0G2JSM1_RAT	UniProtKB/TrEMBL
	A0A0G2K953_RAT	UniProtKB/TrEMBL
	A0A8I6AMI0	ENTREZGENE, UniProtKB/TrEMBL
	A6JBP7	ENTREZGENE, UniProtKB/TrEMBL
	Q8VHV8	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q6PCV8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-09-28	Selenos	selenoprotein S	Vimp	VCP-interacting membrane selenoprotein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-04-29	Vimp	VCP-interacting membrane selenoprotein	Vimp	VCP-interacting membrane protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Vimp	VCP-interacting membrane protein	Sels	selenoprotein S	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-28	Sels	selenoprotein S	SELS	selenoprotein S	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	SELS	selenoprotein S	Ratsg2	Ratsg2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-02-27	Ratsg2	Ratsg2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD