Advanced Search (OLGA)

Gene: Prrx1 (paired related homeobox 1) Rattus norvegicus

Analyze

Symbol:

Prrx1

Name:

paired related homeobox 1

RGD ID:

628884

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; HMG box domain binding activity; and RNA polymerase II general transcription initiation factor activity. Involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in agnathia-otocephaly complex. Orthologous to human PRRX1 (paired related homeobox 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

paired mesoderm homeobox 1; paired mesoderm homeobox protein 1; paired-related homeobox protein 1; Pmx1; Prx-1; rHox

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRRX1 (paired related homeobox 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Prrx1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prrx1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRRX1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRRX1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prrx1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRRX1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRRX1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prrx1 (paired related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PRRX2 (paired related homeobox 2)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Prrx1 (paired related homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PRRX1 (paired related homeobox 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prrx1b (paired related homeobox 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prrx1a (paired related homeobox 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9876	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prrx1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	78,136,783 - 78,205,379 (-)	NCBI		GRCr8
mRatBN7.2	13	75,600,777 - 75,671,896 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	75,601,706 - 75,670,866 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	78,222,273 - 78,288,991 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	79,522,828 - 79,589,543 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	76,777,727 - 76,846,595 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	81,147,038 - 81,215,559 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	81,147,348 - 81,214,546 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	86,039,713 - 86,107,919 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	78,961,648 - 79,028,882 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	78,975,835 - 79,043,069 (-)	NCBI
Celera	13	75,343,320 - 75,409,614 (-)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	1q24 Deletion Syndrome		ISO	RGD:1606834	8554872	ClinVar Annotator: match by term: 1q24q25 microdeletion syndrome	ClinVar	PMID:25741868
Prrx1	Rat	agnathia-otocephaly complex		ISO	RGD:1606834	8554872	ClinVar Annotator: match by term: Agnathia-otocephaly complex \| ClinVar Annotator: match by term: PRRX1-related condition	ClinVar	PMID:12244557\|PMID:21294718\|PMID:22211708\|PMID:22674740\|PMID:23444262\|PMID:25741868\|PMID:28492532
Prrx1	Rat	Craniosynostosis Syndrome, Autosomal Recessive		ISO	RGD:1606834	8554872	ClinVar Annotator: match by term: Craniosynostosis syndrome	ClinVar	PMID:21294718\|PMID:22211708\|PMID:22674740\|PMID:23444262\|PMID:25741868\|PMID:37154149
Prrx1	Rat	gastrointestinal stromal tumor		ISO	RGD:1606834	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Prrx1	Rat	genetic disease		ISO	RGD:1606834	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
Prrx1	Rat	parathyroid carcinoma		ISO	RGD:1606834	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	agnathia-otocephaly complex		ISO	RGD:1606834	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23444262
Prrx1	Rat	atrial fibrillation		ISO	RGD:1606834	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22544366
Prrx1	Rat	demyelinating disease		ISO	RGD:1606834	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30566868
Prrx1	Rat	Prostatic Neoplasms		ISO	RGD:1606834	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19208208
Prrx1	Rat	Retrognathia		ISO	RGD:1606834	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23444262

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	agnathia-otocephaly complex		ISO	RGD:1606834	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1553420	6480464	1,2-Dimethylhydrazine results in decreased expression of PRRX1 mRNA	CTD	PMID:22206623
Prrx1	Rat	17beta-estradiol	increases expression	ISO	RGD:1553420	6480464	Estradiol results in increased expression of PRRX1 mRNA	CTD	PMID:19484750
Prrx1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	multiple interactions	ISO	RGD:1553420	6480464	[Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in decreased expression of more ...	CTD	PMID:38995820
Prrx1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1553420	6480464	Tetrachlorodibenzodioxin affects the expression of PRRX1 mRNA	CTD	PMID:24058054
Prrx1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PRRX1 mRNA	CTD	PMID:34747641
Prrx1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1553420	6480464	Tetrachlorodibenzodioxin results in increased expression of PRRX1 mRNA	CTD	PMID:17586704
Prrx1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1553420	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of PRRX1 mRNA	CTD	PMID:38648751
Prrx1	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	RGD:1553420	6480464	4,4'-diaminodiphenylmethane results in increased expression of PRRX1 mRNA	CTD	PMID:18648102
Prrx1	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1553420	6480464	[bisphenol S co-treated with Tretinoin] results in decreased expression of PRRX1 mRNA	CTD	PMID:30951980
Prrx1	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	RGD:1606834	6480464	bisphenol S results in increased methylation of PRRX1 gene	CTD	PMID:31601247
Prrx1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1553420	6480464	bisphenol S results in increased expression of PRRX1 mRNA	CTD	PMID:30951980
Prrx1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1606834	6480464	Fenretinide results in increased expression of PRRX1 mRNA	CTD	PMID:16570282
Prrx1	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1553420	6480464	Fenretinide results in decreased expression of PRRX1 mRNA	CTD	PMID:28973697
Prrx1	Rat	5-fluorouracil	decreases expression	ISO	RGD:1606834	6480464	Fluorouracil results in decreased expression of PRRX1 mRNA	CTD	PMID:24737281
Prrx1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of PRRX1 mRNA	CTD	PMID:30047161
Prrx1	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of PRRX1 mRNA	CTD	PMID:28959563
Prrx1	Rat	acrylamide	increases expression	ISO	RGD:1553420	6480464	Acrylamide results in increased expression of PRRX1 mRNA	CTD	PMID:30807115
Prrx1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1606834	6480464	Aflatoxin B1 results in decreased methylation of PRRX1 gene; Aflatoxin B1 results in decreased methylation more ...	CTD	PMID:27153756\|PMID:30157460
Prrx1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1606834	6480464	Tretinoin results in decreased expression of PRRX1 mRNA	CTD	PMID:17045167
Prrx1	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1553420	6480464	[bisphenol A co-treated with Tretinoin] results in decreased expression of PRRX1 mRNA; [bisphenol F co-treated more ...	CTD	PMID:30951980
Prrx1	Rat	alpha-Solamarine	multiple interactions	ISO	RGD:1553420	6480464	alpha-solamargine inhibits the reaction [Sevoflurane results in decreased expression of PRRX1 protein]	CTD	PMID:35350913
Prrx1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of PRRX1 mRNA	CTD	PMID:30047161
Prrx1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PRRX1 mRNA	CTD	PMID:16483693
Prrx1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1606834	6480464	Benzo(a)pyrene results in decreased expression of PRRX1 mRNA	CTD	PMID:22316170
Prrx1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1606834	6480464	Benzo(a)pyrene affects the methylation of PRRX1 intron; Benzo(a)pyrene affects the methylation of PRRX1 promoter	CTD	PMID:27901495\|PMID:30157460
Prrx1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1553420	6480464	Benzo(a)pyrene results in increased methylation of PRRX1 exon; Benzo(a)pyrene results in increased methylation of PRRX1 more ...	CTD	PMID:27901495
Prrx1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1606834	6480464	Benzo(a)pyrene results in increased methylation of PRRX1 exon	CTD	PMID:27901495
Prrx1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1553420	6480464	Benzo(a)pyrene results in decreased expression of PRRX1 mRNA	CTD	PMID:22610609
Prrx1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1606834	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of PRRX1 mRNA	CTD	PMID:20382639
Prrx1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1606834	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PRRX1 more ...	CTD	PMID:33872906
Prrx1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1553420	6480464	Diethylhexyl Phthalate results in decreased expression of PRRX1 mRNA	CTD	PMID:34319233
Prrx1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PRRX1 mRNA	CTD	PMID:25181051
Prrx1	Rat	bisphenol A	multiple interactions	ISO	RGD:1606834	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of PRRX1 gene	CTD	PMID:31601247
Prrx1	Rat	bisphenol A	multiple interactions	ISO	RGD:1553420	6480464	[bisphenol A co-treated with Tretinoin] results in decreased expression of PRRX1 mRNA	CTD	PMID:30951980
Prrx1	Rat	bisphenol A	increases expression	ISO	RGD:1553420	6480464	bisphenol A results in increased expression of PRRX1 mRNA	CTD	PMID:30951980
Prrx1	Rat	bisphenol A	affects methylation	ISO	RGD:1553420	6480464	bisphenol A affects the methylation of PRRX1 promoter	CTD	PMID:27334623
Prrx1	Rat	bisphenol F	multiple interactions	ISO	RGD:1553420	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of PRRX1 mRNA	CTD	PMID:30951980
Prrx1	Rat	bisphenol F	increases expression	ISO	RGD:1553420	6480464	bisphenol F results in increased expression of PRRX1 mRNA	CTD	PMID:30951980
Prrx1	Rat	cantharidin	decreases expression	ISO	RGD:1553420	6480464	Cantharidin results in decreased expression of PRRX1 mRNA	CTD	PMID:36907384
Prrx1	Rat	carbon nanotube	increases expression	ISO	RGD:1553420	6480464	Nanotubes, Carbon analog results in increased expression of PRRX1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Prrx1	Rat	cefaloridine	decreases expression	EXP		6480464	Cephaloridine results in decreased expression of PRRX1 mRNA	CTD	PMID:18500788
Prrx1	Rat	CGP 52608	multiple interactions	ISO	RGD:1606834	6480464	CGP 52608 promotes the reaction [RORA protein binds to PRRX1 gene]	CTD	PMID:28238834
Prrx1	Rat	chloroprene	decreases expression	ISO	RGD:1553420	6480464	Chloroprene results in decreased expression of PRRX1 mRNA	CTD	PMID:23125180
Prrx1	Rat	choline	multiple interactions	ISO	RGD:1553420	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Prrx1	Rat	chromium(6+)	affects expression	ISO	RGD:1553420	6480464	chromium hexavalent ion affects the expression of PRRX1 mRNA	CTD	PMID:28472532
Prrx1	Rat	clotrimazole	increases expression	EXP		6480464	Clotrimazole results in increased expression of PRRX1 mRNA	CTD	PMID:30047161
Prrx1	Rat	cobalt dichloride	increases expression	ISO	RGD:1606834	6480464	cobaltous chloride results in increased expression of PRRX1 mRNA	CTD	PMID:19376846
Prrx1	Rat	crocidolite asbestos	affects expression	ISO	RGD:1606834	6480464	Asbestos, Crocidolite affects the expression of PRRX1 mRNA	CTD	PMID:24160326
Prrx1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of PRRX1 mRNA	CTD	PMID:26577399
Prrx1	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of PRRX1 mRNA	CTD	PMID:23914054
Prrx1	Rat	dioxygen	multiple interactions	ISO	RGD:1553420	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PRRX1 mRNA	CTD	PMID:30529165
Prrx1	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of PRRX1 mRNA	CTD	PMID:25152437
Prrx1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1606834	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Prrx1	Rat	doxorubicin	decreases expression	ISO	RGD:1606834	6480464	Doxorubicin results in decreased expression of PRRX1 mRNA	CTD	PMID:29803840
Prrx1	Rat	entinostat	increases expression	ISO	RGD:1606834	6480464	entinostat results in increased expression of PRRX1 mRNA	CTD	PMID:26272509
Prrx1	Rat	entinostat	multiple interactions	ISO	RGD:1606834	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Prrx1	Rat	epoxiconazole	decreases expression	ISO	RGD:1553420	6480464	epoxiconazole results in decreased expression of PRRX1 mRNA	CTD	PMID:35436446
Prrx1	Rat	ethanol	increases expression	ISO	RGD:1553420	6480464	Ethanol results in increased expression of PRRX1 mRNA	CTD	PMID:30319688
Prrx1	Rat	ethyl methanesulfonate	decreases expression	ISO	RGD:1606834	6480464	Ethyl Methanesulfonate results in decreased expression of PRRX1 mRNA	CTD	PMID:23649840
Prrx1	Rat	ethylparaben	increases expression	ISO	RGD:1606834	6480464	ethyl-p-hydroxybenzoate results in increased expression of PRRX1 mRNA	CTD	PMID:37690743
Prrx1	Rat	folic acid	multiple interactions	ISO	RGD:1553420	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Prrx1	Rat	fulvestrant	multiple interactions	ISO	RGD:1606834	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of PRRX1 gene	CTD	PMID:31601247
Prrx1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of PRRX1 mRNA	CTD	PMID:27387713
Prrx1	Rat	GSK-J4	increases expression	ISO	RGD:1606834	6480464	GSK-J4 results in increased expression of PRRX1 mRNA	CTD	PMID:29301935
Prrx1	Rat	hydrogen peroxide	increases expression	ISO	RGD:1606834	6480464	Hydrogen Peroxide results in increased expression of PRRX1 mRNA	CTD	PMID:18951874
Prrx1	Rat	hydroquinone O-beta-D-glucopyranoside	decreases expression	ISO	RGD:1606834	6480464	Arbutin results in decreased expression of PRRX1 mRNA	CTD	PMID:17103032
Prrx1	Rat	indometacin	decreases expression	ISO	RGD:1606834	6480464	Indomethacin results in decreased expression of PRRX1 mRNA	CTD	PMID:24737281
Prrx1	Rat	inulin	multiple interactions	ISO	RGD:1553420	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PRRX1 mRNA	CTD	PMID:36331819
Prrx1	Rat	kojic acid	decreases expression	ISO	RGD:1606834	6480464	kojic acid results in decreased expression of PRRX1 mRNA	CTD	PMID:16595896
Prrx1	Rat	L-methionine	multiple interactions	ISO	RGD:1553420	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Prrx1	Rat	lipopolysaccharide	increases expression	ISO	RGD:1606834	6480464	Lipopolysaccharides results in increased expression of PRRX1 mRNA	CTD	PMID:35811015
Prrx1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1606834	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PRRX1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Prrx1	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of PRRX1 mRNA	CTD	PMID:28801915
Prrx1	Rat	medroxyprogesterone acetate	decreases expression	ISO	RGD:1606834	6480464	Medroxyprogesterone Acetate results in decreased expression of PRRX1 mRNA	CTD	PMID:20843944
Prrx1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of PRRX1 mRNA	CTD	PMID:30047161
Prrx1	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1606834	6480464	Methyl Methanesulfonate results in decreased expression of PRRX1 mRNA	CTD	PMID:23649840
Prrx1	Rat	methylmercury chloride	decreases expression	ISO	RGD:1606834	6480464	methylmercuric chloride results in decreased expression of PRRX1 mRNA	CTD	PMID:28001369
Prrx1	Rat	methylparaben	decreases expression	ISO	RGD:1606834	6480464	methylparaben results in decreased expression of PRRX1 mRNA	CTD	PMID:31745603
Prrx1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1606834	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PRRX1 more ...	CTD	PMID:33872906
Prrx1	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of PRRX1 mRNA; nitrofen results in decreased expression of PRRX1 more ...	CTD	PMID:27665494
Prrx1	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	RGD:1606834	6480464	p-Chloromercuribenzoic Acid results in decreased expression of PRRX1 mRNA	CTD	PMID:26272509
Prrx1	Rat	panobinostat	multiple interactions	ISO	RGD:1606834	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Prrx1	Rat	panobinostat	increases expression	ISO	RGD:1606834	6480464	panobinostat results in increased expression of PRRX1 mRNA	CTD	PMID:26272509
Prrx1	Rat	paracetamol	multiple interactions	ISO	RGD:1553420	6480464	MAP3K5 protein affects the reaction [Acetaminophen results in increased expression of PRRX1 mRNA]	CTD	PMID:18700144
Prrx1	Rat	paracetamol	decreases expression	ISO	RGD:1606834	6480464	Acetaminophen results in decreased expression of PRRX1 mRNA	CTD	PMID:26690555
Prrx1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of PRRX1 mRNA	CTD	PMID:32680482
Prrx1	Rat	PD 0325901	decreases expression	ISO	RGD:1606834	6480464	mirdametinib results in decreased expression of PRRX1 mRNA	CTD	PMID:25119042
Prrx1	Rat	PD 0325901	multiple interactions	ISO	RGD:1606834	6480464	[(+)-JQ1 compound co-treated with mirdametinib] results in decreased expression of PRRX1 mRNA	CTD	PMID:25119042
Prrx1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1553420	6480464	perfluorohexanesulfonic acid results in increased expression of PRRX1 mRNA	CTD	PMID:37995155
Prrx1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1553420	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PRRX1 mRNA	CTD	PMID:36331819
Prrx1	Rat	phenylmercury acetate	decreases expression	ISO	RGD:1606834	6480464	Phenylmercuric Acetate results in decreased expression of PRRX1 mRNA	CTD	PMID:26272509
Prrx1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1606834	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Prrx1	Rat	progesterone	decreases expression	ISO	RGD:1606834	6480464	Progesterone results in decreased expression of PRRX1 mRNA	CTD	PMID:21795739
Prrx1	Rat	rofecoxib	affects expression	ISO	RGD:1606834	6480464	rofecoxib affects the expression of PRRX1 mRNA	CTD	PMID:17070997
Prrx1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1606834	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PRRX1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Prrx1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	decreases expression	ISO	RGD:1606834	6480464	S-(1,2-dichlorovinyl)cysteine results in decreased expression of PRRX1 mRNA	CTD	PMID:35811015
Prrx1	Rat	SB 431542	multiple interactions	ISO	RGD:1606834	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Prrx1	Rat	serpentine asbestos	affects expression	ISO	RGD:1606834	6480464	Asbestos, Serpentine affects the expression of PRRX1 mRNA	CTD	PMID:24160326
Prrx1	Rat	sevoflurane	decreases expression	ISO	RGD:1553420	6480464	Sevoflurane results in decreased expression of PRRX1 protein	CTD	PMID:35350913
Prrx1	Rat	sevoflurane	multiple interactions	ISO	RGD:1553420	6480464	alpha-solamargine inhibits the reaction [Sevoflurane results in decreased expression of PRRX1 protein]	CTD	PMID:35350913
Prrx1	Rat	sodium arsenite	decreases expression	ISO	RGD:1553420	6480464	sodium arsenite results in decreased expression of PRRX1 mRNA	CTD	PMID:37682722
Prrx1	Rat	sulindac sulfide	decreases expression	ISO	RGD:1606834	6480464	sulindac sulfide results in decreased expression of PRRX1 mRNA	CTD	PMID:16184548
Prrx1	Rat	sunitinib	decreases expression	ISO	RGD:1606834	6480464	Sunitinib results in decreased expression of PRRX1 mRNA	CTD	PMID:31533062
Prrx1	Rat	tamoxifen	increases expression	ISO	RGD:1553420	6480464	Tamoxifen results in increased expression of PRRX1 mRNA	CTD	PMID:25123088
Prrx1	Rat	temozolomide	decreases expression	ISO	RGD:1606834	6480464	Temozolomide results in decreased expression of PRRX1 mRNA	CTD	PMID:31758290
Prrx1	Rat	tetrachloromethane	affects expression	ISO	RGD:1553420	6480464	Carbon Tetrachloride affects the expression of PRRX1 mRNA	CTD	PMID:17484886
Prrx1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1553420	6480464	titanium dioxide results in decreased methylation of PRRX1 gene	CTD	PMID:35295148
Prrx1	Rat	trichostatin A	increases expression	ISO	RGD:1606834	6480464	trichostatin A results in increased expression of PRRX1 mRNA	CTD	PMID:24935251
Prrx1	Rat	triclosan	increases expression	ISO	RGD:1606834	6480464	Triclosan results in increased expression of PRRX1 mRNA	CTD	PMID:30510588
Prrx1	Rat	valproic acid	affects expression	ISO	RGD:1553420	6480464	Valproic Acid affects the expression of PRRX1 mRNA	CTD	PMID:17292431
Prrx1	Rat	valproic acid	decreases expression	ISO	RGD:1606834	6480464	Valproic Acid results in decreased expression of PRRX1 mRNA	CTD	PMID:23179753\|PMID:28001369
Prrx1	Rat	valproic acid	increases expression	ISO	RGD:1606834	6480464	Valproic Acid results in increased expression of PRRX1 mRNA	CTD	PMID:24935251
Prrx1	Rat	valproic acid	affects expression	ISO	RGD:1606834	6480464	Valproic Acid affects the expression of PRRX1 mRNA	CTD	PMID:25979313
Prrx1	Rat	valproic acid	increases expression	ISO	RGD:1553420	6480464	Valproic Acid results in increased expression of PRRX1 mRNA	CTD	PMID:24896083

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	artery morphogenesis	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:1857640\|MGI:98218 PMID:10664157	RGD	PMID:10664157
Prrx1	Rat	artery morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	cartilage development	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:1857640\|MGI:98218 PMID:7758948, PMID:9876178	RGD	PMID:7758948\|PMID:9876178
Prrx1	Rat	cartilage development	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	embryonic cranial skeleton morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	embryonic cranial skeleton morphogenesis	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:1857640\|MGI:98218 PMID:7758948, PMID:9729491	RGD	PMID:7758948\|PMID:9729491
Prrx1	Rat	embryonic limb morphogenesis	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:98218 PMID:9729491, PMID:9882503	RGD	PMID:9729491\|PMID:9882503
Prrx1	Rat	embryonic limb morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	embryonic skeletal system morphogenesis	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:1857640\|MGI:98218 PMID:11532916, PMID:7758948, PMID:9729491, PMID:9876178	RGD	PMID:11532916\|PMID:7758948\|PMID:9729491\|PMID:9876178
Prrx1	Rat	embryonic skeletal system morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	inner ear morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	inner ear morphogenesis	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:98218 PMID:9729491	RGD	PMID:9729491
Prrx1	Rat	mesenchymal cell proliferation	acts_upstream_of	ISO	RGD:1553420	1624291	MGI:98218 PMID:11532916	RGD	PMID:11532916
Prrx1	Rat	mesenchymal cell proliferation	acts_upstream_of	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	middle ear morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	middle ear morphogenesis	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:1857640\|MGI:98218 PMID:7758948, PMID:9729491	RGD	PMID:7758948\|PMID:9729491
Prrx1	Rat	negative regulation of transcription by RNA polymerase II		IDA		729501		RGD
Prrx1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1553420	1624291	PMID:20683885	RGD	PMID:20683885
Prrx1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	neuron fate determination	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	PMID:23447615	RGD	PMID:23447615
Prrx1	Rat	neuron fate determination	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	neuronal stem cell population maintenance	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	PMID:23447615	RGD	PMID:23447615
Prrx1	Rat	neuronal stem cell population maintenance	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	positive regulation of mesenchymal cell proliferation	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:98218 PMID:11532916	RGD	PMID:11532916
Prrx1	Rat	positive regulation of mesenchymal cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	positive regulation of smoothened signaling pathway	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:98218 PMID:11532916	RGD	PMID:11532916
Prrx1	Rat	positive regulation of smoothened signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	positive regulation of stem cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	positive regulation of stem cell proliferation	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:98218 PMID:11532916	RGD	PMID:11532916
Prrx1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1606834	1624291	PMID:9334314	RGD	PMID:9334314
Prrx1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P54821\|ensembl:ENSP00000239461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	PMID:23447615	RGD	PMID:23447615
Prrx1	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR017970	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prrx1	Rat	regulation of neuron projection regeneration	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	PMID:23447615	RGD	PMID:23447615
Prrx1	Rat	regulation of neuron projection regeneration	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:97712\|MGI:98218\|PANTHER:PTN002518806\|RGD:628884\|UniProtKB:P54821	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Prrx1	Rat	roof of mouth development	acts_upstream_of_or_within	ISO	RGD:1553420	1624291	MGI:1857640 PMID:7758948	RGD	PMID:7758948
Prrx1	Rat	roof of mouth development	acts_upstream_of_or_within	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	smoothened signaling pathway	acts_upstream_of	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	smoothened signaling pathway	acts_upstream_of	ISO	RGD:1553420	1624291	MGI:98218 PMID:11532916	RGD	PMID:11532916
Prrx1	Rat	stem cell proliferation	acts_upstream_of	ISO	RGD:1553420	1624291	MGI:98218 PMID:11532916	RGD	PMID:11532916
Prrx1	Rat	stem cell proliferation	acts_upstream_of	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	transcription by RNA polymerase II	involved_in	IEA	GO:0016251	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	cytosol	located_in	ISO	RGD:1606834\|UniProtKB:P54821-1\|UniProtKB:P54821-2	1624291		RGD	GO_REF:0000052
Prrx1	Rat	cytosol	located_in	IEA	UniProtKB:P54821\|ensembl:ENSP00000239461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	nucleoplasm	located_in	IEA	UniProtKB:P54821\|ensembl:ENSP00000239461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	nucleoplasm	located_in	ISO	RGD:1606834\|UniProtKB:P54821-1\|UniProtKB:P54821-2	1624291		RGD	GO_REF:0000052
Prrx1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Prrx1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prrx1	Rat	nucleus	located_in	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	nucleus	located_in	ISO	RGD:1553420	1624291	PMID:11748565, PMID:23447615	RGD	PMID:11748565\|PMID:23447615
Prrx1	Rat	nucleus	is_active_in	IBA	MGI:97712\|PANTHER:PTN002518806\|UniProtKB:P54821	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prrx1	Rat	DNA binding	enables	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	DNA binding	enables	IEA	InterPro:IPR001356	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prrx1	Rat	DNA binding	enables	ISO	RGD:1553420	1624291	PMID:15459107	RGD	PMID:15459107
Prrx1	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238\|UniProtKB-KW:KW-0371	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prrx1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	RGD:1606834	1624291	PMID:9334314	RGD	PMID:9334314
Prrx1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P54821\|ensembl:ENSP00000239461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	RGD:1553420	1624291	PMID:23447615	RGD	PMID:23447615
Prrx1	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	InterPro:IPR017970	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prrx1	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	MGI:97712\|MGI:98218\|PANTHER:PTN002518806\|UniProtKB:P54821	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Prrx1	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	RGD:1553420	1624291	PMID:20683885	RGD	PMID:20683885
Prrx1	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	HMG box domain binding	enables	ISO	RGD:1553420	1624291	UniProtKB:Q04886 PMID:16582099	RGD	PMID:16582099
Prrx1	Rat	HMG box domain binding	enables	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	protein binding	enables	ISO	RGD:1606834	1624291	UniProtKB:P51687\|UniProtKB:Q9BW66 PMID:32296183	RGD	PMID:32296183
Prrx1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1606834	1624291	PMID:1509260	RGD	PMID:1509260
Prrx1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:P54821\|ensembl:ENSP00000239461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1553420	1624291	PMID:20683885	RGD	PMID:20683885
Prrx1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:97712\|PANTHER:PTN002518806\|UniProtKB:P54821	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Prrx1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	RNA polymerase II general transcription initiation factor activity	enables	IEA	UniProtKB:P63013\|ensembl:ENSMUSP00000027878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prrx1	Rat	RNA polymerase II general transcription initiation factor activity	enables	ISO	RGD:1553420	1624291	PMID:32188878	RGD	PMID:32188878
Prrx1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	ISO	RGD:1606834	1624291	UniProtKB:P78347 PMID:9334314	RGD	PMID:9334314
Prrx1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	IEA	UniProtKB:P54821\|ensembl:ENSP00000239461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Disease Annotations Click to see Annotation Detail View

1q24 Deletion Syndrome (ISO)

agnathia-otocephaly complex (ISO)

atrial fibrillation (ISO)

Craniosynostosis Syndrome, Autosomal Recessive (ISO)

demyelinating disease (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

parathyroid carcinoma (ISO)

Prostatic Neoplasms (ISO)

Retrognathia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Solamarine (ISO)

amitrole (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chloroprene (ISO)

choline (ISO)

chromium(6+) (ISO)

clotrimazole (EXP)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

decabromodiphenyl ether (EXP)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

ethylparaben (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

indometacin (ISO)

inulin (ISO)

kojic acid (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

medroxyprogesterone acetate (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nitrofen (EXP)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

PD 0325901 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

progesterone (ISO)

rofecoxib (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

sevoflurane (ISO)

sodium arsenite (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

artery morphogenesis (IEA,ISO)

cartilage development (IEA,ISO)

embryonic cranial skeleton morphogenesis (IEA,ISO)

embryonic limb morphogenesis (IEA,ISO)

embryonic skeletal system morphogenesis (IEA,ISO)

inner ear morphogenesis (IEA,ISO)

mesenchymal cell proliferation (IEA,ISO)

middle ear morphogenesis (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IDA,IEA,ISO)

neuron fate determination (IEA,ISO)

neuronal stem cell population maintenance (IEA,ISO)

positive regulation of mesenchymal cell proliferation (IEA,ISO)

positive regulation of smoothened signaling pathway (IEA,ISO)

positive regulation of stem cell proliferation (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of neuron projection regeneration (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

roof of mouth development (IEA,ISO)

smoothened signaling pathway (IEA,ISO)

stem cell proliferation (IEA,ISO)

transcription by RNA polymerase II (IEA)

Cellular Component

cytosol (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

HMG box domain binding (IEA,ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

RNA polymerase II general transcription initiation factor activity (IEA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	rHox: a homeobox gene expressed in osteoblastic cells.	Hu Y, etal., J Cell Biochem 1995 Dec;59(4):486-97.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7758948	PMID:9729491	PMID:9876178	PMID:9882503	PMID:10664157	PMID:11532916	PMID:11748565	PMID:15459107	PMID:16582099	PMID:18296734	PMID:20683885	PMID:22577874
PMID:23447615	PMID:23644741	PMID:24770895	PMID:24881871	PMID:25795141	PMID:27660222	PMID:27665494	PMID:28737764	PMID:31545082

Genomics

Comparative Map Data

Prrx1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	78,136,783 - 78,205,379 (-)	NCBI		GRCr8
mRatBN7.2	13	75,600,777 - 75,671,896 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	75,601,706 - 75,670,866 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	78,222,273 - 78,288,991 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	79,522,828 - 79,589,543 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	76,777,727 - 76,846,595 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	81,147,038 - 81,215,559 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	81,147,348 - 81,214,546 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	86,039,713 - 86,107,919 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	78,961,648 - 79,028,882 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	78,975,835 - 79,043,069 (-)	NCBI
Celera	13	75,343,320 - 75,409,614 (-)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

PRRX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	170,662,768 - 170,739,421 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	170,662,728 - 170,739,421 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	170,633,272 - 170,708,562 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	168,899,937 - 168,975,165 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	143,742,929 - 143,818,153 (+)	NCBI		Celera
Cytogenetic Map	1	q24.2	NCBI
HuRef	1	141,857,178 - 141,932,397 (+)	NCBI		HuRef
CHM1_1	1	172,055,608 - 172,130,854 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	170,018,992 - 170,095,719 (+)	NCBI		T2T-CHM13v2.0

Prrx1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	163,072,688 - 163,142,714 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	163,072,688 - 163,141,279 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	163,245,119 - 163,315,145 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	163,245,119 - 163,313,710 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	165,175,250 - 165,243,781 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	165,081,794 - 165,150,325 (-)	NCBI		MGSCv36	mm8
Celera	1	165,686,221 - 165,753,419 (-)	NCBI		Celera
Cytogenetic Map	1	H2.1	NCBI
cM Map	1	70.53	NCBI

Prrx1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	6,919,899 - 6,991,733 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955462	6,919,905 - 6,991,733 (+)	NCBI	ChiLan1.0	ChiLan1.0

PRRX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	79,023,160 - 79,101,125 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	78,696,682 - 78,773,306 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	146,151,633 - 146,227,926 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	149,867,365 - 149,943,810 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	149,867,634 - 149,943,810 (+)	Ensembl	panpan1.1		panPan2

PRRX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	28,065,570 - 28,138,734 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	28,068,711 - 28,138,787 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	27,598,170 - 27,671,127 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	27,867,506 - 27,940,906 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	27,867,529 - 27,939,818 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	27,717,090 - 27,790,221 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	27,751,956 - 27,825,122 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	27,988,098 - 28,061,291 (-)	NCBI		UU_Cfam_GSD_1.0

Prrx1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	98,358,502 - 98,426,095 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	16,205,240 - 16,272,850 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	16,208,243 - 16,272,836 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRRX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	80,427,687 - 80,501,646 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	80,427,682 - 80,502,689 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	87,973,831 - 88,044,655 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRRX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	58,347,686 - 58,423,454 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	58,347,704 - 58,421,980 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	59,994,168 - 60,070,286 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prrx1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624826	8,361,033 - 8,435,656 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624826	8,361,039 - 8,435,488 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Prrx1
349 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	31
Count of miRNA genes:	27
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000004950
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	69060519	77046890	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	59492522	77046890	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	74023918	80753406	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat

Markers in Region

D13Wox21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	78,203,776 - 78,203,960 (+)	Marker Load Pipeline
Cytogenetic Map	13	q22	UniSTS

RH139243

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	78,203,781 - 78,204,001 (+)	Marker Load Pipeline
mRatBN7.2	13	75,670,589 - 75,670,809 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	81,214,532 - 81,214,751	NCBI	Rnor6.0
Rnor_5.0	13	86,106,915 - 86,107,134	UniSTS	Rnor5.0
RGSC_v3.4	13	79,028,591 - 79,028,810	UniSTS	RGSC3.4
Celera	13	75,409,323 - 75,409,542	UniSTS
RH 3.4 Map	13	471.9	UniSTS
Cytogenetic Map	13	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	85	84	53	25	53	6	212	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_153821	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY730764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S82911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004950 ⟹ ENSRNOP00000004950

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	75,601,706 - 75,670,569 (-)	Ensembl
Rnor_6.0 Ensembl	13	81,147,348 - 81,214,494 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082385 ⟹ ENSRNOP00000075169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	75,603,583 - 75,670,866 (-)	Ensembl
Rnor_6.0 Ensembl	13	81,147,352 - 81,214,546 (-)	Ensembl

RefSeq Acc Id:

NM_153821 ⟹ NP_722543

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	78,136,783 - 78,204,073 (-)	NCBI
mRatBN7.2	13	75,603,583 - 75,670,881 (-)	NCBI
Rnor_6.0	13	81,147,038 - 81,214,823 (-)	NCBI
Rnor_5.0	13	86,039,713 - 86,107,919 (-)	NCBI
RGSC_v3.4	13	78,961,648 - 79,028,882 (-)	RGD
Celera	13	75,343,320 - 75,409,614 (-)	RGD

Sequence:

show sequence

CTTTTTTTTTTTTTCTTTCTGATTTAAGCTTAGCGTGTTTGTTTGTTTGGTTTGGTTTTTAAAC
TTTTTTTGGTGTGGATTATCTCTCTGGACCACGCCGGACTTGGCTTCAGCGAACGAACCGAAGC
TGGGAGAAAGTTACTTGAGCTGAAAGTTCTGCACTTCAGAAGGGGGTTTCTCTCTCTCTCTCTC
TCTCTCTCTCTCTCTCTCTCTCTCCTCCACTCCCCCCTCTTTCTTCCCCACTCGGCTCCTCTCC
CCCCTCACGCCCACAGCGTTTGGTGTTGATTCGAGCGTTAAGAGGGGGGTGGGTGGGATTGGAG
GGAAGACCATGACCTCCAGCTACGGGCACGTTCTGGAGCGGCAACCGGCTCTGGGCGGCCGCTT
GGATAGCCCTGGCAACCTCGACACCCTGCAGGCGAAAAAGAACTTCTCCGTCAGTCACCTGCTA
GACCTGGAGGAGGCCGGGGACATGGTGGCGGCACAGGCGGACGAAAGCGTGGGCGAGGCGGGCC
GGAGCCTGCTGGAGTCACCGGGACTGACCAGTGGCAGCGACACCCCTCAGCAGGACAATGATCA
GCTGAACTCTGAGGAGAAGAAGAAGAGAAAGCAACGGAGAAACAGGACAACCTTCAATAGCAGC
CAGCTGCAGGCCTTGGAGCGTGTCTTCGAGAGGACCCATTACCCGGATGCTTTTGTACGGGAAG
ATCTTGCACGTCGGGTGAACCTCACGGAGGCCAGAGTGCAGGTGTGGTTTCAGAACCGAAGAGC
CAAGTTCCGCAGGAATGAGCGAGCCATGCTGGCCAATAAAAACGCTTCTCTCCTCAAGTCCTAC
TCAGGAGACGTGACTGCCGTGGAACAACCCATTGTACCTCGTCCTGCTCCCAGACCCACCGATT
ATCTCTCCTGGGGGACAGCCTCTCCGTACAGCGCCATGGCTACTTATTCTGCCACATGTGCCAA
CAATAGCCCTGCGCAGGGTATCAACATGGCCAACAGCATTGCCAACCTGAGACTGAAGGCCAAG
GAATATAGTTTACAGAGGAACCAGGTGCCAACAGTCAACTGAGGAAAAAAATAATTAAACAGGC
CTAAGAAGAAATCAAAAACCATAAGACACCTATCCTGTTCTGTCATTTCTTCATCCGCTGGAAA
AAAAAGATAAAAGCAAACAAACAAAGCCAGAACTAAAATATTGGGACCATGGCGGAGAAAAGCA
GGAGAGGAACAAAATGAAAATTAGTTAACAAATGTTTCTTCTTCCTCTTGGATACCATCACCAT
TTGTTGTGTGTGTATTTTTTTTCCTTCTACCCATGCTTTGCTAAGTATACTTCAGGCTTCTTCT
ATTAGGCTCAACCCACCCATTCCTATAATTG

hide sequence

RefSeq Acc Id:

XM_006250151 ⟹ XP_006250213

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	78,137,053 - 78,205,379 (-)	NCBI
mRatBN7.2	13	75,600,777 - 75,671,896 (-)	NCBI
Rnor_6.0	13	81,147,352 - 81,215,559 (-)	NCBI
Rnor_5.0	13	86,039,713 - 86,107,919 (-)	NCBI

Sequence:

show sequence

TCCGGCTCTGATGTTGGCAAAGGGGTTTTCTTAATCAGACTGTTTTTTCAGTCCGAGGAAAAGG
AGGTAGGAGATTGTGATGGAGAAAGGGGGTCTGTAAAACGTCAGGCGCCGCACAAAGGCTTTGC
CACGTAATTACAGGCTCCTATTAAGTGGAGATCTGCCCTCCCAGGGGTCTCCAATTTTCTTGTA
TTCCCTACAAAGCCTCCTCTCCATGCCAGTCTGTGCCTTTTGAAGTGCCAGAGAGCTTCTTGAT
CCAACTGAGAAGGGAAAAGGAGCTGCGCACGGAGAAGGGGGAGAGAGCGGAGGGAAGGGGGACC
CGCCACCCTTCTGCAGACTCTTGAAGCCCCACTTCTTTATTTCTTATTTTTTCCTCCTTCGAAG
AGTAAAGTGAGAATCCTGCTCTCTAATACATCTGCAAGACATCACTCTCCTGAAATTCTAGTCA
CTCCCGAGAATCCACAGGAGTGCAGAGAGGGGGAACGCGCTTTCTTGAAGACATTTTAAAGCTG
GAACAAGCCTCCTTCTGTTGGTGCTTGAACTCTTGCCGGGGAATAACTTTTTTAACCTCTTTCT
CTACTTTTTTTTTAAAACCCACTTTGATTCTTCTCTCCACCCCTTCTTCTCTCTTCTGTTTGCC
TAACTCCCCCGCCCTGTTGGCCTCCCCTTTCCTCTCTCCCCCTTATTATTATTTTTAGTGTCTG
CGTTGTAGACGCTTTTTGAGAATTGGAAGGGATTTTTTTTTCTTTCTGATTTAAGCTTAGCGTG
TTTGTTTGTTTGGTTTGGTTTTTAAACTTTTTTTGGTGTGGATTATCTCTCTGGACCACGCCGG
ACTTGGCTTCAGCGAAGCAACCGAAGCTGGGAGAAAGTTACTTGTGCTGAAAGTTCTGCACTTC
AGAAGGGGGTTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCCTCCACT
CCCCCCTCTTTCTTCCCCACTCGGCTCCTCTCCCCCCTCACGCCCACAGCGTTTGGTGTTGATT
CGAGCGGGAAGAGGGGGGTGGGTGGGATTGGAGGGAAGACCATGACCTCCAGCTACGGGCACGT
TCTGGAGCGGCAACCGGCTCTGGGCGGCCGCTTGGATAGCCCTGGCAACCTCGACACCCTGCAG
GCGAAAAAGAACTTCTCCGTCAGTCACCTGCTAGACCTGGAGGAGGCCGGGGACATGGTGGCGG
CACAGGCGGACGAAAGCGTGGGCGAGGCGGGCCGGAGCCTGCTGGAGTCACCGGGACTGACCAG
TGGCAGCGACACCCCTCAGCAGGACAATGATCAGCTGAACTCTGAGGAGAAGAAGAAGAGAAAG
CAACGGAGAAACAGGACAACCTTCAATAGCAGCCAGCTGCAGGCCTTGGAGCGTGTCTTCGAGA
GGACCCATTACCCGGATGCTTTTGTACGGGAAGATCTTGCACGTCGGGTGAACCTCACGGAGGC
CAGAGTGCAGGTGTGGTTTCAGAACCGAAGAGCCAAGTTCCGCAGGAATGAGCGAGCCATGCTG
GCCAATAAAAACGCTTCTCTCCTCAAGTCCTACTCAGGAGACGTGACTGCCGTGGAACAACCCA
TTGTACCTCGTCCTGCTCCCAGACCCACCGATTATCTCTCCTGGGGGACAGCCTCTCCGTACAG
ATCTTCGTCCCTCCCAAGATGTTGTTTACACGAGGGGCTTCATAACGGATTCTAACGGAAGACA
CTGAAAAGCGCCATGGCTACTTATTCTGCCACATGTGCCAACAATAGCCCTGCGCAGGGTATCA
ACATGGCCAACAGCATTGCCAACCTGAGACTGAAGGCCAAGGAATATAGTTTACAGAGGAACCA
GGTGCCAACAGTCAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_722543	(Get FASTA)	NCBI Sequence Viewer
	XP_006250213	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB46839	(Get FASTA)	NCBI Sequence Viewer
	AAU21314	(Get FASTA)	NCBI Sequence Viewer
	EDM09377	(Get FASTA)	NCBI Sequence Viewer
	EDM09378	(Get FASTA)	NCBI Sequence Viewer
	EDM09379	(Get FASTA)	NCBI Sequence Viewer
	EDM09380	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004950
	ENSRNOP00000004950.5
	ENSRNOP00000075169
	ENSRNOP00000075169.2
GenBank Protein	P63014	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_722543 ⟸ NM_153821

- UniProtKB:

Q643W9 (UniProtKB/Swiss-Prot), P63014 (UniProtKB/Swiss-Prot), A6IDB7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSL
LESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLA
RRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLS
WGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN

hide sequence

RefSeq Acc Id:	XP_006250213 ⟸ XM_006250151
- Peptide Label:	isoform X1
- UniProtKB:	P63014 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSL LESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLA RRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLS WGTASPYRSSSLPRCCLHEGLHNGF hide sequence

Ensembl Acc Id:

ENSRNOP00000075169 ⟸ ENSRNOT00000082385

Ensembl Acc Id:

ENSRNOP00000004950 ⟸ ENSRNOT00000004950

Protein Domains

Homeobox OAR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P63014-F1-model_v2	AlphaFold	P63014	1-245	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698947

Promoter ID:

EPDNEW_R9472

Type:

initiation region

Name:

Prrx1_1

Description:

paired related homeobox 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	81,214,473 - 81,214,533	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628884	AgrOrtholog
BioCyc Gene	G2FUF-17628	BioCyc
Ensembl Genes	ENSRNOG00000003720	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004950	ENTREZGENE
	ENSRNOT00000004950.7	UniProtKB/Swiss-Prot
	ENSRNOT00000082385	ENTREZGENE
	ENSRNOT00000082385.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	OAR_dom	UniProtKB/Swiss-Prot
	PRRX1/2	UniProtKB/Swiss-Prot
KEGG Report	rno:266813	UniProtKB/Swiss-Prot
NCBI Gene	266813	ENTREZGENE
PANTHER	PAIRED MESODERM HOMEOBOX PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR46385	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	OAR	UniProtKB/Swiss-Prot
PhenoGen	Prrx1	PhenoGen
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
	OAR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003720	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
UniProt	A6IDB7	ENTREZGENE, UniProtKB/TrEMBL
	A6IDB9_RAT	UniProtKB/TrEMBL
	A6IDC0_RAT	UniProtKB/TrEMBL
	P63014	ENTREZGENE, UniProtKB/Swiss-Prot
	Q643W9	ENTREZGENE
UniProt Secondary	P43271	UniProtKB/Swiss-Prot
	Q02810	UniProtKB/Swiss-Prot
	Q643W9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-03-01	Prrx1	paired related homeobox 1	Pmx1	paired mesoderm homeobox 1	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2003-02-27	Pmx1	paired mesoderm homeobox 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM