Fzd9 (frizzled class receptor 9) - Rat Genome Database

Name: Fzd9
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Fzd9 (frizzled class receptor 9) Rattus norvegicus

Analyze

Symbol:

Fzd9

Name:

frizzled class receptor 9

RGD ID:

628817

Description:

Enables Wnt receptor activity. Involved in Wnt signaling pathway; postsynapse organization; and regulation of postsynaptic cytosolic calcium ion concentration. Is active in glutamatergic synapse and postsynapse. Orthologous to human FZD9 (frizzled class receptor 9); PARTICIPATES IN Wnt signaling pathway; basal cell carcinoma pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

frizzled 9; frizzled family receptor 9; frizzled homolog 9; frizzled homolog 9 (Drosophila); frizzled-9; Frizzled-like protein 9; rFz9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FZD9 (frizzled class receptor 9)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fzd9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fzd9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FZD9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FZD9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fzd9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FZD9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FZD9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fzd9 (frizzled class receptor 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FZD10 (frizzled class receptor 10)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	FZD9 (frizzled class receptor 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fzd9 (frizzled class receptor 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fzd9a (frizzled class receptor 9a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fzd9b (frizzled class receptor 9b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cfz-2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	fz3	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	fzd9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,063,640 - 27,065,954 (+)	NCBI		GRCr8
mRatBN7.2	12	21,427,084 - 21,429,398 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,427,084 - 21,429,398 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,568,651 - 22,570,965 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,180,980 - 23,183,294 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,247,456 - 22,249,770 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,473,981 - 24,476,295 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,473,981 - 24,476,295 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,471,284 - 26,473,598 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,581,510 - 22,583,824 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	22,572,254 - 22,574,569 (+)	NCBI
Celera	12	23,189,657 - 23,191,971 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

intestinal volvulus (ISO)

Neurodevelopmental Disorders (ISO)

pleomorphic xanthoastrocytoma (ISO)

schizophrenia (ISO)

Volvulus Of Midgut (ISO)

Williams-Beuren syndrome (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-palmitoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

calciol (ISO)

cannabidiol (EXP)

chlorpyrifos (EXP)

choline (ISO)

chromium(6+) (ISO)

Cuprizon (EXP)

dexamethasone (ISO)

diazinon (EXP)

dibutyl phthalate (ISO)

dieldrin (EXP)

folic acid (ISO)

fonofos (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

hydrazine (ISO)

indometacin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

mifepristone (ISO)

nickel atom (EXP)

niclosamide (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (ISO)

sunitinib (ISO)

terbufos (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

B cell differentiation (ISO)

bone regeneration (ISO,ISS)

canonical Wnt signaling pathway (IBA)

G protein-coupled receptor signaling pathway (IEA)

learning or memory (ISO)

negative regulation of neuron apoptotic process (ISO,ISS)

negative regulation of skeletal muscle acetylcholine-gated channel clustering (ISO,ISS)

neuroblast proliferation (ISO)

non-canonical Wnt signaling pathway (IBA)

ossification (ISO,ISS)

positive regulation of bone mineralization (ISO,ISS)

positive regulation of canonical Wnt signaling pathway (ISO,ISS)

positive regulation of neural precursor cell proliferation (ISO,ISS)

postsynapse organization (IDA,IMP)

regulation of cell cycle (ISO,ISS)

regulation of postsynaptic cytosolic calcium ion concentration (IDA,IMP)

regulation of skeletal muscle acetylcholine-gated channel clustering (ISO,ISS)

Wnt signaling pathway (IDA)

Cellular Component

cell surface (ISO)

cytoplasm (ISO)

filopodium membrane (ISO)

glutamatergic synapse (IDA,IEP,IMP)

perinuclear region of cytoplasm (ISO)

plasma membrane (IBA,ISO)

postsynapse (IDA,IEP)

Molecular Function

G protein-coupled receptor activity (IEA)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

Wnt receptor activity (IBA,IDA,ISO)

Wnt-protein binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Wnt signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The p53 transcriptional target gene wnt7b contributes to NGF-inducible neurite outgrowth in neuronal PC12 cells.	Brynczka C and Merrick BA, Differentiation. 2008 Jan 2;.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Frizzled-9 is activated by Wnt-2 and functions in Wnt/beta -catenin signaling.	Karasawa T, etal., J Biol Chem 2002 Oct 4;277(40):37479-86.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	Wnt-5a/Frizzled9 Receptor Signaling through the Gao-Gß¿ Complex Regulates Dendritic Spine Formation.	Ramírez VT, etal., J Biol Chem. 2016 Sep 2;291(36):19092-107. doi: 10.1074/jbc.M116.722132. Epub 2016 Jul 11.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA

Additional References at PubMed

PMID:10198163	PMID:14688793	PMID:15572594	PMID:15930120	PMID:19038973	PMID:20458727	PMID:21402791	PMID:24391920	PMID:24860427	PMID:27509850	PMID:37585277

Genomics

Comparative Map Data

Fzd9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,063,640 - 27,065,954 (+)	NCBI		GRCr8
mRatBN7.2	12	21,427,084 - 21,429,398 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,427,084 - 21,429,398 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,568,651 - 22,570,965 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,180,980 - 23,183,294 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,247,456 - 22,249,770 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,473,981 - 24,476,295 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,473,981 - 24,476,295 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,471,284 - 26,473,598 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,581,510 - 22,583,824 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	22,572,254 - 22,574,569 (+)	NCBI
Celera	12	23,189,657 - 23,191,971 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

FZD9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,433,778 - 73,436,120 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,433,778 - 73,436,120 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	72,848,108 - 72,850,450 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,486,045 - 72,488,386 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	72,292,963 - 72,295,149	NCBI
Celera	7	68,326,020 - 68,328,361 (+)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	68,729,438 - 68,731,779 (+)	NCBI		HuRef
CHM1_1	7	72,993,577 - 72,995,918 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	74,634,272 - 74,636,614 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,181,181 - 72,183,522 (+)	NCBI

Fzd9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,277,792 - 135,279,901 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,277,792 - 135,280,084 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	135,248,938 - 135,251,047 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,248,938 - 135,251,230 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,724,808 - 135,726,917 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,533,564 - 135,535,674 (-)	NCBI		MGSCv36	mm8
Celera	5	132,260,609 - 132,262,718 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	75.08	NCBI

Fzd9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	14,246,324 - 14,247,550 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	14,245,994 - 14,247,551 (-)	NCBI	ChiLan1.0	ChiLan1.0

FZD9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,465,742 - 91,468,899 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,730,373 - 139,733,539 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,588,167 - 80,590,337 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,588,167 - 80,590,337 (+)	Ensembl	panpan1.1		panPan2

FZD9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,782,394 - 6,784,565 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	6,782,774 - 6,784,558 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,479,582 - 8,481,722 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,597,879 - 6,600,019 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,598,235 - 6,600,019 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,573,034 - 6,575,174 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,535,346 - 6,537,484 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,698,260 - 6,700,400 (-)	NCBI		UU_Cfam_GSD_1.0

Fzd9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,326,748 - 131,328,721 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,707,840 - 2,709,498 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,707,846 - 2,709,819 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FZD9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	10,754,783 - 10,757,147 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	10,753,294 - 10,762,812 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,454,083 - 10,460,062 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FZD9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,621,434 - 9,623,769 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,621,770 - 9,623,545 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	6,849,337 - 6,851,686 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fzd9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,323,817 - 14,325,601 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	14,323,445 - 14,325,616 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fzd9
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	42
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000001973
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
631521	Pia12	Pristane induced arthritis QTL 12	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	20259417	23672083	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

Fzd9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,428,617 - 21,428,886 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,475,515 - 24,475,783	NCBI	Rnor6.0
Rnor_5.0	12	26,472,818 - 26,473,086	UniSTS	Rnor5.0
RGSC_v3.4	12	22,583,044 - 22,583,312	UniSTS	RGSC3.4
Celera	12	23,191,191 - 23,191,459	UniSTS
Cytogenetic Map	12	q12	UniSTS

UniSTS:230791

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,428,631 - 21,428,886 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,475,529 - 24,475,783	NCBI	Rnor6.0
Rnor_5.0	12	26,472,832 - 26,473,086	UniSTS	Rnor5.0
RGSC_v3.4	12	22,583,058 - 22,583,312	UniSTS	RGSC3.4
Celera	12	23,191,205 - 23,191,459	UniSTS
Cytogenetic Map	12	q12	UniSTS

Fzd10

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,428,566 - 21,428,745 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,475,464 - 24,475,642	NCBI	Rnor6.0
Rnor_5.0	12	26,472,767 - 26,472,945	UniSTS	Rnor5.0
RGSC_v3.4	12	22,582,993 - 22,583,171	UniSTS	RGSC3.4
Celera	12	23,191,140 - 23,191,318	UniSTS
Cytogenetic Map	12	q12	UniSTS

Fzd9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,428,866 - 21,429,353 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,475,764 - 24,476,250	NCBI	Rnor6.0
Rnor_5.0	12	26,473,067 - 26,473,553	UniSTS	Rnor5.0
RGSC_v3.4	12	22,583,293 - 22,583,779	UniSTS	RGSC3.4
Celera	12	23,191,440 - 23,191,926	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	65	62	33	25	33	6	192	97	93	45	59	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_153305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC090529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF455054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ211688	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ211689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001973 ⟹ ENSRNOP00000001973

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,427,084 - 21,429,398 (+)	Ensembl
Rnor_6.0 Ensembl	12	24,473,981 - 24,476,295 (+)	Ensembl

RefSeq Acc Id:

NM_153305 ⟹ NP_695217

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,063,640 - 27,065,954 (+)	NCBI
mRatBN7.2	12	21,427,084 - 21,429,398 (+)	NCBI
Rnor_6.0	12	24,473,981 - 24,476,295 (+)	NCBI
Rnor_5.0	12	26,471,284 - 26,473,598 (+)	NCBI
RGSC_v3.4	12	22,581,510 - 22,583,824 (+)	RGD
Celera	12	23,189,657 - 23,191,971 (+)	RGD

Sequence:

show sequence

GGAGCTGCTGCGGCTGGCGGCTGAGACCGCGCCGGCTCTGGCTGGAGTGGCGGCGGCAGCGGCG
GCGGCGACAGCGACGGCGACGGCGGTGGTAGCGGCTGTTCTTCCGAAGGCGCCGCGCGCTCCAG
GACACACGTGGGCGGCCGAGAGATGGCGTGGGACCCGCGACGTGGCGCGCAGATCCCGGGACGC
GGGATGGAGCGGCGCGTGTGAGCCGGGGCGGCCGCGCCGCGGGGCGATGGCGGTGCCACCGCTG
CTCCGCGGGGCGCTGCTGCTGTGGCAGCTGCTGGCGACGGGCGGCGCGGCGCTGGAGATCGGCC
GCTTTGATCCGGAGCGCGGCCGTGGCCCCGCACCGTGCCAAGCGATGGAGATCCCCATGTGCCG
GGGCATCGGCTACAACCTGACCCGCATGCCCAACCTACTGGGCCACACGTCGCAGGGCGAGGCG
GCCGCGCAGCTGGCCGAGTTCTCGCCTCTCGTGCAGTACGGCTGCCACAGCCACCTGCGCTTCT
TCCTCTGCTCGCTCTACGCCCCAATGTGCACCGACCAGGTCTCCACTCCCATCCCCGCCTGCCG
GCCCATGTGCGAGCAGGCTCGCCTGCGCTGCGCCCCCATCATGGAGCAATTCAATTTCGGCTGG
CCGGACTCCCTCGACTGTGCCCGGCTCCCCACGCGCAACGACCCGCACGCGCTCTGCATGGAGG
CACCCGAGAACGCTACCGCAGGCCCCACAGAACCCCACAAGGGCCTGGGCATGCTTCCTGTAGC
ACCTCGGCCCGCGAGGCCACCGGGAGATTCAGCCCCCGGTCCGGGCAGTGGAGGCACCTGCGAC
AACCCCGAGAAGTTCCAGTACGTGGAGAAGAGTCGCTCGTGCGCTCCGCGCTGCGGGCCAGGCG
TCGAGGTGTTCTGGTCTCGGCGCGATAAGGACTTCGCGCTGGTCTGGATGGCTGTGTGGTCCGC
GTTGTGTTTCTTCTCCACGGCCTTCACCGTGTTCACCTTCCTGCTGGAGCCTCACCGATTCCAG
TACCCAGAGCGCCCTATAATCTTCCTTTCCATGTGCTACAATGTCTACTCCTTGGCCTTCCTGA
TCAGAGCGGTGGCAGGTGCACAGAGTGTGGCCTGCGACCAGGAGGCAGGGGCTCTGTATGTGAT
CCAGGAGGGTTTGGAAAACACAGGCTGCACCCTGGTCTTCCTATTGCTCTATTATTTCGGGATG
GCCAGCTCACTTTGGTGGGTGGTTTTGACTCTCACCTGGTTCCTGGCTGCAGGCAAAAAGTGGG
GCCACGAAGCCATCGAGGCTCACGGTAGTTACTTCCACATGGCAGCGTGGGGCTTGCCAGCACT
CAAGACTATCGTGGTCCTGACTCTACGTAAGGTGGCTGGGGATGAGCTGACTGGGCTCTGCTAT
GTAGCTAGCATGGACCCGGCAGCTCTCACTGGCTTTGTGTTGGTGCCCCTCTCTTGCTACTTGG
TACTGGGCACCAGTTTCCTCCTGACAGGTTTTGTGGCTCTCTTCCATATCCGCAAAATTATGAA
GACGGGCGGCACCAATACAGAGAAGCTGGAGAAGCTGATGGTGAAAATCGGAGTCTTTTCCATC
CTTTACACAGTGCCGGCTACCTGCGTCATTGTCTGCTATGTTTACGAACGCCTCAACATGGACT
TCTGGCGTCTTCGGGCCACAGAGCAACCATGCACTGCCGCTGCCGTGCCTGGAGGCCGGAGAGA
CTGCTCGCTGCCAGGGGGCTCGGTGCCCACTGTGGCCGTCTTCATGCTCAAAATCTTCATGTCC
TTGGTGGTGGGCATCACCAGTGGAGTCTGGGTATGGAGTTCCAAGACTTTCCAGACTTGGCAGA
GTCTATGTTACCGAAAAATGGCAGCTGGTCGAGCCCGGGCCAAGGCCTGCCGAACCCCAGGGGG
CTATGGCCGGGGTACCCACTGTCACTACAAAGCCCCCACGGTGGTCTTGCACATGACTAAGACA
GACCCCTCTCTGGAGAACCCCACACACCTCTAGAACATAGGCTGGGCTGAGTTATGGTTGCTCC
CTCCTTGCCCTCCCCTCCCCCCCTCCAGAGACAGCTGACTAACAGCTGCCCAGCTGTCAAGGTC
AGACAAGTGAGACACAGGGGGCTGAGGACTAGGGTGGGGACCCAGTAAAGCTCAGGGCCTTGTC
TTTCCTTCTCAGGCAGGGAGTGGGCCTAGTTAAGTCCACAGAGGGTCCTAGGATCAGAAGGGGC
AGAGGTGGGGCAGGGTCCAGAGCAGAGTTTATTTAATGATGTAATTTATTGTGGCATTTCTCTG
GAAGCTGTGAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_695217	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAN03014	(Get FASTA)	NCBI Sequence Viewer
	ABB20593	(Get FASTA)	NCBI Sequence Viewer
	ABB20594	(Get FASTA)	NCBI Sequence Viewer
	EDM13380	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001973.2
	ENSRNOP00055000571
	ENSRNOP00060016682
	ENSRNOP00065001696
GenBank Protein	Q8K4C8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_695217 ⟸ NM_153305
- Peptide Label:	precursor
- UniProtKB:	Q8K4C8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPNLLGH TSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIME QFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPG SGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLL EPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLL LYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDE LTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVK IGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCTAAAVPGGRRDCSLPGGSVPTVAVFM LKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVV LHMTKTDPSLENPTHL hide sequence

Ensembl Acc Id:

ENSRNOP00000001973 ⟸ ENSRNOT00000001973

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8K4C8-F1-model_v2	AlphaFold	Q8K4C8	1-592	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628817	AgrOrtholog
BioCyc Gene	G2FUF-19612	BioCyc
Ensembl Genes	ENSRNOG00000001452	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055000406	UniProtKB/Swiss-Prot
	ENSRNOG00060012483	UniProtKB/Swiss-Prot
	ENSRNOG00065001814	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001973.4	UniProtKB/Swiss-Prot
	ENSRNOT00055000718	UniProtKB/Swiss-Prot
	ENSRNOT00060021146	UniProtKB/Swiss-Prot
	ENSRNOT00065002423	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.2000.10	UniProtKB/Swiss-Prot
	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	Frizzled/SFRP	UniProtKB/Swiss-Prot
	Frizzled/Smoothened_TM	UniProtKB/Swiss-Prot
	Frizzled_dom	UniProtKB/Swiss-Prot
	Frizzled_dom_sf	UniProtKB/Swiss-Prot
	FZ9_CRD	UniProtKB/Swiss-Prot
	GPCR_2-like	UniProtKB/Swiss-Prot
KEGG Report	rno:266608	UniProtKB/Swiss-Prot
NCBI Gene	266608	ENTREZGENE
PANTHER	FRIZZLED-9	UniProtKB/Swiss-Prot
	PTHR11309	UniProtKB/Swiss-Prot
Pfam	Frizzled	UniProtKB/Swiss-Prot
	PF01392	UniProtKB/Swiss-Prot
PhenoGen	Fzd9	PhenoGen
PRINTS	FRIZZLED	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F2_4	UniProtKB/Swiss-Prot
	PS50038	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001452	RatGTEx
	ENSRNOG00055000406	RatGTEx
	ENSRNOG00060012483	RatGTEx
	ENSRNOG00065001814	RatGTEx
SMART	FRI	UniProtKB/Swiss-Prot
	Frizzled	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF63501	UniProtKB/Swiss-Prot
UniProt	FZD9_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-02-06	Fzd9	frizzled class receptor 9	Fzd9	frizzled family receptor 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Fzd9	frizzled family receptor 9	Fzd9	frizzled homolog 9 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fzd9	frizzled homolog 9 (Drosophila)			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Fzd9	frizzled homolog 9 (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	functions as a Wnt/beta-catenin signaling receptor	632661
gene_mutations_overexpression	in mouse overexpression induces hyperphosphorylation and relocalization of cytosolic beta-catenin	632661

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - KEGG (archival)