Advanced Search (OLGA)

Gene: Cacng8 (calcium voltage-gated channel auxiliary subunit gamma 8) Rattus norvegicus

Analyze

Symbol:

Cacng8

Name:

calcium voltage-gated channel auxiliary subunit gamma 8

RGD ID:

628808

Description:

Enables ionotropic glutamate receptor binding activity and protein phosphatase 2B binding activity. Involved in positive regulation of AMPA receptor activity. Located in dendrite membrane and postsynaptic membrane. Part of AMPA glutamate receptor complex. Is active in glutamatergic synapse and postsynaptic density membrane. Orthologous to human CACNG8 (calcium voltage-gated channel auxiliary subunit gamma 8); PARTICIPATES IN arrhythmogenic right ventricular cardiomyopathy pathway; dilated cardiomyopathy pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH 17beta-estradiol; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

calcium channel, voltage-dependent, gamma subunit 8; neuronal voltage-gated calcium channel gamma-8 subunit; TARP gamma-8; transmembrane AMPAR regulatory protein gamma-8; voltage-dependent calcium channel gamma-8 subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	74,670,767 - 74,691,003 (-)	NCBI		GRCr8
mRatBN7.2	1	65,755,334 - 65,775,567 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	65,755,334 - 65,779,089 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	71,203,496 - 71,223,728 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	79,626,484 - 79,646,716 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	72,959,544 - 72,979,828 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	64,330,106 - 64,350,338 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	64,330,106 - 64,350,338 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	63,321,710 - 63,341,943 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	64,068,324 - 64,088,556 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	64,145,070 - 64,165,304 (-)	NCBI
Celera	1	63,480,060 - 63,499,712 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

antisocial personality disorder (ISS)

dilated cardiomyopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

6-propyl-2-thiouracil (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

aspartame (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Butylparaben (EXP)

CGP 52608 (ISO)

chromium(6+) (ISO)

copper atom (ISO)

copper(0) (ISO)

entinostat (ISO)

enzacamene (EXP)

ethylbenzene (ISO)

iron dichloride (ISO)

lead(0) (ISO)

methotrexate (ISO)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (ISO)

Nor-9-carboxy-delta9-THC (ISO)

resveratrol (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

toluene (EXP,ISO)

trichloroethene (EXP)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion transmembrane transport (IEA)

calcium ion transport (IEA)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

positive regulation of AMPA receptor activity (IDA)

positive regulation of synaptic transmission, glutamatergic (IBA)

postsynaptic neurotransmitter receptor diffusion trapping (IBA)

regulation of AMPA receptor activity (IDA,ISO)

regulation of postsynaptic membrane neurotransmitter receptor levels (ISO)

transmission of nerve impulse (IBA)

Cellular Component

AMPA glutamate receptor complex (IBA,IDA,IEA)

dendrite membrane (IDA)

glutamatergic synapse (IDA,IEP,ISO)

L-type voltage-gated calcium channel complex (ISO,ISS)

membrane (IEA)

monoatomic ion channel complex (IEA)

plasma membrane (IEA)

postsynaptic density (IEA,ISO,ISS)

postsynaptic density membrane (IBA,IDA,IEA,IEP,ISO)

postsynaptic membrane (IDA,IEA)

Schaffer collateral - CA1 synapse (ISO)

synapse (IEA)

Molecular Function

calcium channel activity (IEA)

calcium channel regulator activity (ISO,ISS)

channel regulator activity (IBA)

ionotropic glutamate receptor binding (IDA)

protein binding (IPI,ISO)

protein phosphatase 2B binding (IPI)

voltage-gated calcium channel activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

arrhythmogenic right ventricular cardiomyopathy pathway (IEA)

dilated cardiomyopathy pathway (IEA)

hypertrophic cardiomyopathy pathway (IEA)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Calcium channel gamma subunits provide insights into the evolution of this gene family.	Chu PJ, etal., Gene 2001 Dec 12;280(1-2):37-48.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein gamma-8 with calcineurin.	Itakura M, etal., FEBS J. 2014 Mar;281(5):1366-78. doi: 10.1111/febs.12708. Epub 2014 Jan 27.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	TARP subtypes differentially and dose-dependently control synaptic AMPA receptor gating.	Milstein AD, etal., Neuron. 2007 Sep 20;55(6):905-18.
7.	Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction.	Ortega A, etal., PLoS One. 2015 Dec 28;10(12):e0145518. doi: 10.1371/journal.pone.0145518. eCollection 2015.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Functional proteomics identify cornichon proteins as auxiliary subunits of AMPA receptors.	Schwenk J, etal., Science. 2009 Mar 6;323(5919):1313-9. doi: 10.1126/science.1167852.
12.	Selective regulation of long-form calcium-permeable AMPA receptors by an atypical TARP, gamma-5.	Soto D, etal., Nat Neurosci. 2009 Mar;12(3):277-85. doi: 10.1038/nn.2266. Epub 2009 Feb 22.
13.	Functional studies and distribution define a family of transmembrane AMPA receptor regulatory proteins.	Tomita S, etal., J Cell Biol. 2003 May 26;161(4):805-16. doi: 10.1083/jcb.200212116.
14.	Dynamic interaction of stargazin-like TARPs with cycling AMPA receptors at synapses.	Tomita S, etal., Science 2004 Mar 5;303(5663):1508-11.

Additional References at PubMed

PMID:17074043	PMID:20805473	PMID:21127204	PMID:21172611	PMID:22871113	PMID:25495042	PMID:25931508	PMID:26725511	PMID:27076426	PMID:29490264	PMID:30872532	PMID:35136046

Genomics

Comparative Map Data

Cacng8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	74,670,767 - 74,691,003 (-)	NCBI		GRCr8
mRatBN7.2	1	65,755,334 - 65,775,567 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	65,755,334 - 65,779,089 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	71,203,496 - 71,223,728 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	79,626,484 - 79,646,716 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	72,959,544 - 72,979,828 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	64,330,106 - 64,350,338 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	64,330,106 - 64,350,338 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	63,321,710 - 63,341,943 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	64,068,324 - 64,088,556 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	64,145,070 - 64,165,304 (-)	NCBI
Celera	1	63,480,060 - 63,499,712 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

CACNG8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	53,962,937 - 53,990,215 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	53,962,937 - 53,990,215 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	54,466,191 - 54,493,469 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	59,158,106 - 59,177,951 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	59,158,105 - 59,177,951	NCBI
Celera	19	51,505,965 - 51,525,810 (+)	NCBI		Celera
Cytogenetic Map	19	q13.42	NCBI
HuRef	19	50,783,089 - 50,809,780 (+)	NCBI		HuRef
CHM1_1	19	54,468,073 - 54,495,260 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	57,041,427 - 57,068,705 (+)	NCBI		T2T-CHM13v2.0

Cacng8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	3,442,558 - 3,464,782 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	3,439,199 - 3,464,164 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	3,394,042 - 3,416,266 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	3,390,683 - 3,415,648 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	3,394,459 - 3,415,366 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
Celera	7	3,346,589 - 3,368,017 (+)	NCBI		Celera
Cytogenetic Map	7	A1	NCBI
cM Map	7	1.98	NCBI

Cacng8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955604	204,482 - 221,833 (-)	NCBI	ChiLan1.0	ChiLan1.0

CACNG8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	59,970,553 - 59,996,884 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	61,892,343 - 61,918,671 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	50,899,256 - 50,920,028 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	59,745,315 - 59,772,864 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

CACNG8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	103,245,102 - 103,263,154 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	103,250,132 - 103,263,178 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	103,311,932 - 103,324,845 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	103,900,218 - 103,913,136 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	103,900,218 - 103,913,241 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	103,532,913 - 103,545,825 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	103,294,645 - 103,307,574 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	104,013,588 - 104,026,528 (-)	NCBI		UU_Cfam_GSD_1.0

Cacng8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	2,778,679 - 2,802,840 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936994	146,550 - 159,122 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CACNG8
(Sus scrofa - pig)

No map positions available.

CACNG8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	46,649,793 - 46,670,918 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	46,649,865 - 46,670,452 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	26,727,009 - 26,748,041 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cacng8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624832	2,505,057 - 2,517,886 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cacng8
109 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	58
Count of miRNA genes:	55
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000019300
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

RH140816

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	65,757,856 - 65,757,980 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	64,332,630 - 64,332,753	NCBI	Rnor6.0
Rnor_5.0	1	63,324,235 - 63,324,358	UniSTS	Rnor5.0
RGSC_v3.4	1	64,070,848 - 64,070,971	UniSTS	RGSC3.4
Celera	1	63,481,996 - 63,482,119	UniSTS
RH 3.4 Map	1	740.8	UniSTS
Cytogenetic Map	1	q12	UniSTS

BE102334

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	65,774,891 - 65,775,067 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	64,349,663 - 64,349,838	NCBI	Rnor6.0
Rnor_5.0	1	63,341,268 - 63,341,443	UniSTS	Rnor5.0
RGSC_v3.4	1	64,087,881 - 64,088,056	UniSTS	RGSC3.4
Celera	1	63,499,037 - 63,499,212	UniSTS
RH 3.4 Map	1	741.5	UniSTS
Cytogenetic Map	1	q12	UniSTS

ECD23507

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	65,755,909 - 65,756,097 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	64,330,682 - 64,330,869	NCBI	Rnor6.0
Rnor_5.0	1	63,322,286 - 63,322,473	UniSTS	Rnor5.0
RGSC_v3.4	1	64,068,900 - 64,069,087	UniSTS	RGSC3.4
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	6	24	111	50	43	25	16	25	6	126	60	93	31	60	18

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF361346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078444 ⟹ ENSRNOP00000075354

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	65,755,334 - 65,779,089 (-)	Ensembl
Rnor_6.0 Ensembl	1	64,330,106 - 64,350,338 (-)	Ensembl

RefSeq Acc Id:

NM_080696 ⟹ NP_542427

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	74,670,767 - 74,691,003 (-)	NCBI
mRatBN7.2	1	65,755,334 - 65,775,567 (-)	NCBI
Rnor_6.0	1	64,330,106 - 64,350,338 (-)	NCBI
Rnor_5.0	1	63,321,710 - 63,341,943 (-)	NCBI
RGSC_v3.4	1	64,068,324 - 64,088,556 (-)	RGD
Celera	1	63,480,060 - 63,499,712 (-)	RGD

Sequence:

show sequence

CTGGAATCATTGAAACGCTGGAATGAAGAGAGGGGTTTGTGGTGCGAAAAGGGCGTTCAGGTAC
TACTGACCACCATAGGCGCCTTTGCAGCTTTTGGCCTCATGACCATCGCCATCAGCACTGACTA
CTGGCTCTACACAAGAGCTCTCATCTGCAACACCACCAACCTCACAGCAGGTGATGATGGACCA
CCCCATCGTGGGGGCAGTGGCTCCTCAGAGAAGAAGGACCCTGGGGGCCTCACACATTCAGGCC
TCTGGCGGATATGCTGCCTGGAAGGGTTGAAAAGAGGTGTCTGCGTGAAGATCAACCACTTCCC
GGAGGACACGGACTACGACCACGACAGCGCGGAGTACCTGCTCCGAGTAGTCCGGGCCTCCAGC
ATCTTTCCTATCCTGAGCGCCATCCTGCTGCTGCTCGGGGGCGTGTGCGTAGCTGCCTCTCGCG
TCTACAAATCCAAAAGGAACATCATCCTGGGCGCAGGGATCCTGTTCGTGGCAGCAGGCCTGAG
CAACATCATCGGGGTGATCGTGTACATATCGGCAAACGCGGGCGAGCCAGGCCCCAAGAGGGAC
GAGGAGAAGAAAAACCACTATTCGTATGGCTGGTCCTTCTACTTCGGCGGGCTGTCATTCATCC
TGGCCGAGGTGATCGGCGTGCTAGCCGTCAACATCTACATCGAGCGCAGCCGCGAGGCACACTG
CCAATCACGCTCGGACCTACTCAAGGCCGGCGGCGGCGCGGGCGGCAGTGGCGGGAGCGGCCCC
TCGGCCATCCTCCGTCTGCCCAGTTACCGCTTCCGCTACCGCCGCCGCTCCCGCTCCAGCTCCC
GAGGCTCCAGCGAGGCCTCGCCATCGCGGGATGCGTCTCCCGGCGGCCCCGGGGGCCCGGGCTT
CGCCTCCACGGACATCTCCATGTACACGCTCAGTCGCGACCCGTCCAAGGGCAGCGTGGCTGCG
GGGCTGGCGAGCGCCGGGGGTGGAGGCGGCGGTGCCGGCGTGGGTGCCTACGGCGGGGCGGCCG
GGGCAGCGGGGGGCGGCGGGACGGGCTCGGAGCGGGACCGAGGGAGCTCAGCGGGCTTCCTCAC
GCTGCACAACGCCTTCCCCAAGGAGGCGGCGTCCGGCGTCACGGTCACGGTCACCGGACCGCCC
GCTGCGCCGGCGCCCGCGCCGCCCGCTCCTGCAGCGCCCGCGCCCGGGACGCTGTCCAAAGAGG
CCGCCGCGTCCAACACCAACACGCTCAACAGGAAAACCACGCCCGTGTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_542427	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL50041	(Get FASTA)	NCBI Sequence Viewer
	EDL84945	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000075354
GenBank Protein	Q8VHW5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_542427 ⟸ NM_080696

- UniProtKB:

Q8VHW5 (UniProtKB/Swiss-Prot), F1M7K7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MESLKRWNEERGLWCEKGVQVLLTTIGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAGDDGP
PHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLLRVVRASS
IFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGEPGPKRD
EEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSDLLKAGGGAGGSGGSGP
SAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFASTDISMYTLSRDPSKGSVAA
GLASAGGGGGGAGVGAYGGAAGAAGGGGTGSERDRGSSAGFLTLHNAFPKEAASGVTVTVTGPP
AAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKTTPV

hide sequence

Ensembl Acc Id:

ENSRNOP00000075354 ⟸ ENSRNOT00000078444

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VHW5-F1-model_v2	AlphaFold	Q8VHW5	1-421	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628808	AgrOrtholog
BioCyc Gene	G2FUF-61025	BioCyc
Ensembl Genes	ENSRNOG00000057848	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000078444	ENTREZGENE
Gene3D-CATH	1.20.140.150	UniProtKB/Swiss-Prot
InterPro	CACNG_subunit	UniProtKB/Swiss-Prot
	PMP22/EMP/MP20/Claudin	UniProtKB/Swiss-Prot
	VDCC_g8su	UniProtKB/Swiss-Prot
	VDCC_gsu	UniProtKB/Swiss-Prot
KEGG Report	rno:140729	UniProtKB/Swiss-Prot
NCBI Gene	140729	ENTREZGENE
PANTHER	VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA SUBUNIT	UniProtKB/Swiss-Prot
	VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA-8 SUBUNIT	UniProtKB/Swiss-Prot
Pfam	PMP22_Claudin	UniProtKB/Swiss-Prot
PhenoGen	Cacng8	PhenoGen
PRINTS	VDCCGAMMA	UniProtKB/Swiss-Prot
	VDCCGAMMA8	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000057848	RatGTEx
UniProt	A6KS38_RAT	UniProtKB/TrEMBL
	CCG8_RAT	UniProtKB/Swiss-Prot
	F1M7K7	ENTREZGENE, UniProtKB/TrEMBL
	Q8VHW5	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Cacng8	calcium voltage-gated channel auxiliary subunit gamma 8	Cacng8	calcium channel, voltage-dependent, gamma subunit 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Cacng8	calcium channel, voltage-dependent, gamma subunit 8		voltage-dependent calcium channel gamma-8 subunit	Name updated	1299863	APPROVED
2003-02-27	Cacng8	voltage-dependent calcium channel gamma-8 subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)