Advanced Search (OLGA)

Gene: Pxmp4 (peroxisomal membrane protein 4) Rattus norvegicus

Analyze

Symbol:

Pxmp4

Name:

peroxisomal membrane protein 4

RGD ID:

628782

Description:

Predicted to act upstream of or within ether lipid metabolic process. Located in peroxisomal membrane. Orthologous to human PXMP4 (peroxisomal membrane protein 4); INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

24 kDa peroxisomal intrinsic membrane protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PXMP4 (peroxisomal membrane protein 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pxmp4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pxmp4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PXMP4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PXMP4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pxmp4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PXMP4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PXMP4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pxmp4 (peroxisomal membrane protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PXMP4 (peroxisomal membrane protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pxmp4 (peroxisomal membrane protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wu:fe02h09	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F18F11.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pxmp4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	163,553,582 - 163,570,829 (-)	NCBI		GRCr8
GRCr8 Ensembl	3	163,553,599 - 163,570,829 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	3	143,093,371 - 143,110,620 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	143,093,018 - 143,110,651 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	146,960,120 - 146,978,105 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	155,578,214 - 155,595,443 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	153,317,678 - 153,334,925 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	150,091,646 - 150,108,893 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	150,091,630 - 150,108,898 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	156,464,180 - 156,481,427 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	145,061,123 - 145,078,370 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	141,826,005 - 141,843,209 (-)	NCBI		Celera
RGSC_v3.1	3	144,966,757 - 144,983,992 (-)	NCBI
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

glutathione synthetase deficiency (ISO)

glutatione synthetase deficiency with 5-oxoprolinuria (ISO)

hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase (ISO)

long QT syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diquat (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

ethanol (EXP)

folic acid (ISO)

GSK-J4 (ISO)

indometacin (EXP,ISO)

isotretinoin (ISO)

linalool (EXP)

lipopolysaccharide (ISO)

menadione (ISO)

metformin (EXP)

methapyrilene (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

nickel atom (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

oxycodone (EXP)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pinosylvin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

resveratrol (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sevoflurane (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

succimer (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

topotecan (EXP)

trans-pinosylvin (ISO)

tributylstannane (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vitamin E (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ether lipid metabolic process (IEA,ISO)

Cellular Component

membrane (IEA)

peroxisomal membrane (IBA,IDA,IEA,ISO)

peroxisome (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
3.	Identification of a 24 kDa intrinsic membrane protein from mammalian peroxisomes.	Reguenga C, etal., Biochim Biophys Acta. 1999 Jun 9;1445(3):337-41.
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Information Derived from GenBank Report	RGD, Sept. 2003
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14709540	PMID:15489334

Genomics

Comparative Map Data

Pxmp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	163,553,582 - 163,570,829 (-)	NCBI		GRCr8
GRCr8 Ensembl	3	163,553,599 - 163,570,829 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	3	143,093,371 - 143,110,620 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	143,093,018 - 143,110,651 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	146,960,120 - 146,978,105 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	155,578,214 - 155,595,443 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	153,317,678 - 153,334,925 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	150,091,646 - 150,108,893 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	150,091,630 - 150,108,898 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	156,464,180 - 156,481,427 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	145,061,123 - 145,078,370 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	141,826,005 - 141,843,209 (-)	NCBI		Celera
RGSC_v3.1	3	144,966,757 - 144,983,992 (-)	NCBI
Cytogenetic Map	3	q41	NCBI

PXMP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	33,702,758 - 33,720,310 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	33,702,758 - 33,720,319 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	32,290,564 - 32,308,116 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	31,754,211 - 31,771,797 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	31,758,175 - 31,771,764	NCBI
Celera	20	29,043,230 - 29,060,852 (-)	NCBI		Celera
Cytogenetic Map	20	q11.22	NCBI
HuRef	20	29,076,249 - 29,093,560 (-)	NCBI		HuRef
CHM1_1	20	32,191,931 - 32,209,516 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	35,429,114 - 35,446,666 (-)	NCBI		T2T-CHM13v2.0

Pxmp4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	154,427,678 - 154,445,592 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	154,427,678 - 154,445,628 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	154,585,758 - 154,603,730 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	154,585,758 - 154,603,708 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	154,412,780 - 154,429,409 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	154,278,485 - 154,295,114 (-)	NCBI		MGSCv36	mm8
Celera	2	160,503,519 - 160,520,519 (-)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	76.79	NCBI

Pxmp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	27,602,348 - 27,617,901 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	27,602,348 - 27,617,901 (+)	NCBI	ChiLan1.0	ChiLan1.0

PXMP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	39,396,894 - 39,411,532 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	39,383,703 - 39,409,841 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	29,987,418 - 30,007,941 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	31,128,389 - 31,145,602 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	31,128,390 - 31,145,602 (-)	Ensembl	panpan1.1		panPan2

PXMP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	22,916,336 - 22,930,082 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	22,918,363 - 22,930,036 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	22,561,317 - 22,575,345 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	23,602,816 - 23,616,908 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	23,581,862 - 23,616,878 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	22,895,274 - 22,909,325 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	22,988,833 - 23,002,856 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	23,419,917 - 23,433,941 (-)	NCBI		UU_Cfam_GSD_1.0

Pxmp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	171,867,902 - 171,883,820 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	6,865,722 - 6,882,575 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	6,865,751 - 6,880,878 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PXMP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	17	37,194,130 - 37,218,250 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	42,143,660 - 42,150,773 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PXMP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	37,997,919 - 38,013,423 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	37,998,072 - 38,013,289 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	88,868,032 - 88,883,956 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pxmp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	5,573,196 - 5,588,729 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624842	5,573,427 - 5,588,645 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pxmp4
68 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	240
Count of miRNA genes:	158
Interacting mature miRNAs:	173
Transcripts:	ENSRNOT00000022914
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161492708	189428310	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161799493	176036425	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	161799270	187311134	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	141508991	166376254	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	160357340	167835660	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY151834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022914 ⟹ ENSRNOP00000022914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	163,553,599 - 163,570,829 (-)	Ensembl
mRatBN7.2 Ensembl	3	143,093,018 - 143,110,651 (-)	Ensembl
Rnor_6.0 Ensembl	3	150,091,630 - 150,108,898 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098907 ⟹ ENSRNOP00000093630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	143,093,018 - 143,103,914 (-)	Ensembl

RefSeq Acc Id:

NM_172223 ⟹ NP_757377

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	163,553,582 - 163,570,829 (-)	NCBI
mRatBN7.2	3	143,093,371 - 143,110,620 (-)	NCBI
Rnor_6.0	3	150,091,646 - 150,108,893 (-)	NCBI
Rnor_5.0	3	156,464,180 - 156,481,427 (-)	NCBI
RGSC_v3.4	3	145,061,123 - 145,078,370 (-)	RGD
Celera	3	141,826,005 - 141,843,209 (-)	RGD

Sequence:

show sequence

TGCTTGGCCAGCTAGGTCCTTCGACCCAGTGCTCCGGTGCTATGGCTGCCCCGCCGCAGCTACG
GGCTCTTCTCCAGGCTGTCAACAAGCTGCTGCGCCAGCGCCGTTACCACGCTGCGCTGGCCGTG
ATAAAGGGCTTCCGGAACGGGGCTGTCTATGGAGTCAAAATCCGGGCGCCTCATGCACTGGTGA
TGACCTTTCTCTTCAGGAGTGGCAGTCTCCAAGAGAAGCTGCAGGCCATTCTGAAAGCCACGTA
CACCCACTCTCGGAACCTGGCCTGCTTCGTCTTCACCTATAAGAGTCTCCAGGCCCTACAGTCC
CATGTGCAAGGTGGGACCCACCAGATGCACTCTTTCCTGGCTGCCTTCATCGGGGGGCTCCTGC
TGTTTGGAGAGAACAATAACATTAATAGCCAGATCAACATGTACCTGACATCACGTGTCCTGTT
TGCCTTGTGCCGCCTGGGTGTGGAGAAGGGCTACATCCCTGCGCTCAAGTGGGACCCGTTCCCC
TTACACACGGCGGTGATTTGGGGGCTTGTGCTGTGGCTCTTTGAGTATCACCGGCCCACTCTGC
AGCCCTCACTACAGTCCTCCATGACCTACCTCTACGAGGACAGCAACGTGTGGCACGACCTCTC
AGACTTCCTCATCTTCAACAAGAGCCGCCCCTCCAAGTAACACAGCCCAAGGTGCTTCGGGAAC
TCCAACGCCCAGACAGCTTCCAGGCAGCGTCCCGCTGCTGCTCAGGGTACCGTTCTATTGGCAT
ACCGTCATGGAGGATCCTGCCTTCTCAAAGTCATGGACCTCACACTCCAACTTTTATTATCCCA
GGCTCCCACTTGCTGAAGGAAAAGTACCGAGGTTTACGCCTGCCTCCGGATACTGTAGCAAGTG
GCTGGATCCAGCTAAGGATTCCAGATGCTCTTCCGACCTCTGTAAGGCCAGGGCGAGTTCAACC
CTCTCTGGGCCTCAGGTCATTCAGTTCAGGGGAGGACCCTCAGAGGAGAGTGTCCTCCTGGGGG
ATACGGTGACCCTCCCCTCTACTGTGTATCAGAGGGCTCCTTGCTACTGGGCAATAGGTTACAA
ATACTTTGAAAGGGAAAAAAAAACTAAATTCTTTGTCTAAGTTATTCTACCGAGACGTTCCGGA
CGGAACCCTACTGTCCAATGGGAACGAAACATGAGCCATTCGATAGAGGTACAGCACGTGCCAG
GCTTGTGCGAGATCCTATCACCAGCACTGAGAATAAAACGCCTAGTGACCACATTTCTGAGATG
CATTAAGAAGGCTGTGGCACTAGGGTTATGAGCTCCAGGCCAGGCTGGGATACATTAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_757377	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH81699	(Get FASTA)	NCBI Sequence Viewer
	AAN72218	(Get FASTA)	NCBI Sequence Viewer
	EDL85955	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022914
	ENSRNOP00000022914.4
GenBank Protein	P59382	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_757377 ⟸ NM_172223

- UniProtKB:

P59382 (UniProtKB/Swiss-Prot), A6KI00 (UniProtKB/TrEMBL), A0A8I6AJZ1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAPPQLRALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSLQEKL
QAILKATYTHSRNLACFVFTYKSLQALQSHVQGGTHQMHSFLAAFIGGLLLFGENNNINSQINM
YLTSRVLFALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQPSLQSSMTYLYED
SNVWHDLSDFLIFNKSRPSK

hide sequence

Ensembl Acc Id:

ENSRNOP00000022914 ⟸ ENSRNOT00000022914

Ensembl Acc Id:

ENSRNOP00000093630 ⟸ ENSRNOT00000098907

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P59382-F1-model_v2	AlphaFold	P59382	1-212	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692576

Promoter ID:

EPDNEW_R3101

Type:

initiation region

Name:

Pxmp4_1

Description:

peroxisomal membrane protein 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	150,108,895 - 150,108,955	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628782	AgrOrtholog
BioCyc Gene	G2FUF-47168	BioCyc
Ensembl Genes	ENSRNOG00000016975	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022914	ENTREZGENE
	ENSRNOT00000022914.6	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7193564	IMAGE-MGC_LOAD
InterPro	Pmp4	UniProtKB/Swiss-Prot
KEGG Report	rno:282634	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93086	IMAGE-MGC_LOAD
NCBI Gene	282634	ENTREZGENE
PANTHER	PEROXISOMAL MEMBRANE PROTEIN 4	UniProtKB/Swiss-Prot
	PTHR15460	UniProtKB/Swiss-Prot
Pfam	Tim17	UniProtKB/Swiss-Prot
PhenoGen	Pxmp4	PhenoGen
PIRSF	PXMP4	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016975	RatGTEx
UniProt	A0A8I6AJZ1	ENTREZGENE, UniProtKB/TrEMBL
	A6KI00	ENTREZGENE, UniProtKB/TrEMBL
	P59382	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Pxmp4	peroxisomal membrane protein 4			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Pxmp4	peroxisomal membrane protein 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar