Ppm1g (protein phosphatase, Mg2+/Mn2+ dependent, 1G)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ppm1g (protein phosphatase, Mg2+/Mn2+ dependent, 1G) Rattus norvegicus

Analyze

Symbol:

Ppm1g

Name:

protein phosphatase, Mg2+/Mn2+ dependent, 1G

RGD ID:

628676

Description:

Predicted to enable protein serine/threonine phosphatase activity. Predicted to be involved in peptidyl-threonine dephosphorylation. Predicted to act upstream of or within regulation of cell cycle. Predicted to be located in nucleus. Predicted to be active in nucleoplasm. Orthologous to human PPM1G (protein phosphatase, Mg2+/Mn2+ dependent 1G); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC366566; protein phosphatase 1G; protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	25,153,556 - 25,173,763 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	25,153,556 - 25,173,761 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	25,454,397 - 25,474,600 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	25,770,290 - 25,790,493 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	25,249,656 - 25,269,625 (+)	NCBI	Rnor_WKY
Rnor_6.0	6	26,517,840 - 26,537,292 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,517,840 - 26,537,290 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,336,359 - 36,355,555 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,145,569 - 25,149,811 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	25,148,980 - 25,152,355	NCBI
Celera	6	24,645,573 - 24,665,067 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

schizophrenia (ISS)

short-rib thoracic dysplasia 10 with or without polydactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

4-amino-2,6-dinitrotoluene (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

carmustine (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (ISO)

dibutyl phthalate (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

ivermectin (ISO)

lead diacetate (ISO)

lead(0) (ISO)

lead(2+) (ISO)

methidathion (ISO)

miconazole (ISO)

nickel dichloride (EXP)

nitric oxide (ISO)

oxaliplatin (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

rotenone (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiophenes (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

peptidyl-threonine dephosphorylation (IEA,ISO)

protein dephosphorylation (IBA,ISO)

regulation of cell cycle (IEA,ISO)

Cellular Component

cytoplasm (IEA)

membrane (IEA)

nucleoplasm (IBA,IEA,ISO)

nucleus (ISO)

Molecular Function

metal ion binding (IEA)

myosin phosphatase activity (IEA)

phosphoprotein phosphatase activity (ISO)

protein binding (IPI,ISO)

protein serine/threonine phosphatase activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	FIN13, a novel growth factor-inducible serine-threonine phosphatase which can inhibit cell cycle progression.	Guthridge MA, etal., Mol Cell Biol 1997 Sep;17(9):5485-98.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	ARC protects rat cardiomyocytes against oxidative stress through inhibition of caspase-2 mediated mitochondrial pathway.	Zhang YQ and Herman B, J Cell Biochem. 2006 Oct 1;99(2):575-88.

Additional References at PubMed

PMID:20801214

Genomics

Comparative Map Data

Ppm1g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	25,153,556 - 25,173,763 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	25,153,556 - 25,173,761 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	25,454,397 - 25,474,600 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	25,770,290 - 25,790,493 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	25,249,656 - 25,269,625 (+)	NCBI	Rnor_WKY
Rnor_6.0	6	26,517,840 - 26,537,292 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,517,840 - 26,537,290 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,336,359 - 36,355,555 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,145,569 - 25,149,811 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	25,148,980 - 25,152,355	NCBI
Celera	6	24,645,573 - 24,665,067 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

PPM1G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	27,381,199 - 27,409,591 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	27,381,195 - 27,409,591 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	27,604,066 - 27,632,458 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	27,457,565 - 27,486,000 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	27,515,712 - 27,544,147	NCBI
Celera	2	27,450,727 - 27,478,104 (-)	NCBI		Celera
Cytogenetic Map	2	p23.3	NCBI
HuRef	2	27,346,069 - 27,374,440 (-)	NCBI		HuRef
CHM1_1	2	27,534,014 - 27,562,499 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	27,423,594 - 27,451,985 (-)	NCBI		T2T-CHM13v2.0

Ppm1g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	31,360,012 - 31,377,889 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	31,360,008 - 31,378,031 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	31,202,668 - 31,220,545 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	31,202,664 - 31,220,687 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	31,505,041 - 31,522,918 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	31,479,249 - 31,497,126 (-)	NCBI		MGSCv36	mm8
Celera	5	28,681,717 - 28,699,620 (-)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	17.27	NCBI

Ppm1g
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	9,344,968 - 9,350,125 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	9,344,968 - 9,350,123 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPM1G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	27,473,480 - 27,502,384 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	27,473,480 - 27,502,384 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	27,385,072 - 27,413,475 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PPM1G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	21,336,319 - 21,356,278 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	21,336,604 - 21,356,283 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	21,228,084 - 21,248,046 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	21,657,649 - 21,677,648 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	21,657,652 - 21,677,623 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	21,344,295 - 21,364,251 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	21,354,011 - 21,374,011 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	21,402,010 - 21,421,995 (-)	NCBI		UU_Cfam_GSD_1.0

Ppm1g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	65,636,528 - 65,656,720 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	5,182,818 - 5,203,072 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936493	5,182,829 - 5,203,037 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPM1G
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	111,748,105 - 111,770,901 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	111,748,012 - 111,770,868 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	118,703,500 - 118,726,303 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPM1G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	80,205,359 - 80,230,391 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	80,205,458 - 80,230,424 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	31,921,834 - 31,947,912 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppm1g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624738	9,454,798 - 9,479,141 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppm1g
52 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	55
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000031842
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
1359023	Bp272	Blood pressure QTL 272	2.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	16536140	27261739	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat

Markers in Region

Ppm1g

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	25,173,582 - 25,173,715 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,537,112 - 26,537,244	NCBI	Rnor6.0
Rnor_5.0	6	36,355,375 - 36,355,507	UniSTS	Rnor5.0
RGSC_v3.4	6	25,149,631 - 25,149,763	UniSTS	RGSC3.4
Celera	6	24,664,887 - 24,665,019	UniSTS
Cytogenetic Map	6	q14	UniSTS

PPM1G_7857

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	25,173,197 - 25,173,730 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,536,727 - 26,537,259	NCBI	Rnor6.0
Rnor_5.0	6	36,354,990 - 36,355,522	UniSTS	Rnor5.0
RGSC_v3.4	6	25,149,246 - 25,149,778	UniSTS	RGSC3.4
Celera	6	24,664,502 - 24,665,034	UniSTS
Cytogenetic Map	6	q14	UniSTS

UniSTS:496035

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	25,172,097 - 25,172,188 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,535,627 - 26,535,717	NCBI	Rnor6.0
Rnor_5.0	6	36,353,890 - 36,353,980	UniSTS	Rnor5.0
RGSC_v3.4	6	25,148,146 - 25,148,236	UniSTS	RGSC3.4
Celera	6	24,663,402 - 24,663,492	UniSTS
Cytogenetic Map	6	q14	UniSTS

G54114

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	25,173,438 - 25,173,602 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,536,968 - 26,537,131	NCBI	Rnor6.0
Rnor_5.0	6	36,355,231 - 36,355,394	UniSTS	Rnor5.0
RGSC_v3.4	6	25,149,487 - 25,149,650	UniSTS	RGSC3.4
Celera	6	24,664,743 - 24,664,906	UniSTS
Cytogenetic Map	6	q14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	36	50	34	19	34	6	9	74	35	41	11	6
Low		7	7	7		7	2	2					2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_147209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF525687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000031842 ⟹ ENSRNOP00000029414

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	25,153,556 - 25,173,761 (+)	Ensembl
Rnor_6.0 Ensembl	6	26,517,840 - 26,537,290 (+)	Ensembl

RefSeq Acc Id:

NM_147209 ⟹ NP_671742

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	25,153,556 - 25,173,763 (+)	NCBI
Rnor_6.0	6	26,517,840 - 26,537,292 (+)	NCBI
Rnor_5.0	6	36,336,359 - 36,355,555 (+)	NCBI
RGSC_v3.4	6	25,145,569 - 25,149,811 (+)	RGD
Celera	6	24,645,573 - 24,665,067 (+)	RGD

Sequence:

show sequence

CCTTGCGTCGGCTGCGCAGCCGGGCCCGCTCCTTGCCACGCGCGCCCCCGGGGGCCCCGGCTCC
GGCGCCGGCAAGGGTCGCGTCCCGCTCACCTGCCCCACAGGCAGCTAGCCATCCGCCGCCATGG
GTGCCTACCTCTCTCAGCCCAACACGGTGAAGTGCTCCGGGGACGGGGTTGGCGCCCCGCGGCT
CCCGCTGCCCTACGGCTTCTCCGCCATGCAAGGCTGGCGCGTCTCCATGGAGGATGCTCACAAC
TGTATTCCTGAGCTGGACAATGAGACAGCTATGTTTTCTGTCTACGACGGACATGGAGGGGAAG
AGGTCGCCTTGTACTGTGCCAAATATCTTCCTGATATTATCAAAGATCAGAAGGCCTACAAGGA
AGGCAAGCTTCAGAAGGCTTTACAAGATGCCTTCTTGGCTATCGATGCCAAGCTGACTACAGAT
GAAGTCATTAAGGAACTGGCGCAGATTGCAGGGAGACCCACTGAAGATGAGGATGATAAAGAAA
AAGTAGCAGATGAGGATGATGTGGACAATGAGGAGGCTGCATTGCTGCATGAGGAGGCTACCAT
GACTATTGAAGAGTTGCTGACACGATATGGGCAGAACTGTCAGAAGGGCCCTCCCCACACCAAA
TCTGGAACTGGGATAGGTGATGAACCAGAGCCCCAGGGCCTCAATGGTGAGGCTGGACCTGAGG
ACCCATCTAGGGAAACTCCTTCCCAGGAAAATGGCCCCACAGCCAAAGGCCACACAGGCCCTTC
CTCCAACTCAGACCATGGGACTGAGGCAGGCCAAATTGGTGAGCCCGGTACTGCTACTGGTGAG
GCTGGACCTTCCTGCTCTTCAGCCTCTGACAAGCTGCCTCGAGTTGCTAAGTCCAAGTTCTTTG
AGGACAGTGAGGATGAATCAGATGAGGTGGAGGAGGAAGAGGATGACAGTGAGGAATGTAGTGA
GGACGAGGACGGCTACAGCAGTGAGGAGGCAGAGAACGAGGAGGACGAGGATGACACGGAGGAG
GCTGAAGAGGATGACGATGAAGAGATGATGGTCCCTGGAATGGAAGGCAAAGAGGAGCCTGGCT
CTGACAGTGGCACAACAGCAGTGGTGGCTCTCATACGAGGGAAGCAGTTGATTGTGGCCAATGC
AGGAGACTCTCGCTGTGTGGTGTCTGAGGCTGGCAAAGCTTTAGATATGTCCTATGACCACAAA
CCAGAGGATGAAGTGGAGCTGGCACGGATCAAGAATGCTGGTGGCAAGGTCACCATGGATGGAC
GAGTCAATGGAGGTCTCAACCTCTCCAGGGCCATTGGAGACCACTTCTACAAGAGAAACAAAAA
CTTGCCCCCCCAGGAACAGATGATTTCTGCCCTTCCTGACATCAAGGTGCTGACTCTCACTGAT
GACCATGAATTCATGGTCATTGCTTGTGACGGCATCTGGAATGTGATGAGCAGCCAGGAAGTTG
TAGACTTTATTCAATCAAAGATCAGCCAACGTGATGAAAATGGGGAGCTTCGGTTATTGTCATC
CATTGTGGAAGAGCTGCTGGATCAGTGTCTGGCCCCAGACACTTCTGGGGATGGTACAGGGTGT
GACAACATGACGTGCATCATCATTTGCTTCAAGCCCCGAAACACAGTAGAGCTTCAGCCAGAGA
GTGGCAAGAGGAAACTGGAGGAGGCACTCTCCACGGAGGGGGCTGAAGAGAATGGCAACAGTGA
CAAGAAGAAGGCCAAGCGGGACTAGCAGTCAACCGGACCCTGCCCACCTGGACTGTTCTGAGCC
CTTGGACCCGAGACTGAGTTTTGTCCTTTTCTTTTAGCCTTAGCAGTGGGTATGAGGTGTGTAG
GGGGCTGGGCGGCTTTCCTCAGCCCATTCCAAAGAGGGCTCTCCCTCTGGACGCGGCAGCCTGG
GAGCCTCTGCTGTCCTCTCCAGCCTCCTCCTTACTCCTTGGGCTCATCGACTATCGGTTCTGTG
CCTGTGCTCTGTTGTGTTGGAGGGAAGGACTGGTAGTTCTGATTTTTACTCTGTGAACACTTTA
TTTAAGGACATTCTTTTTTATTGGCGGCTCTGTGACCCCTAGCCGCTTGCACCCGCTCTCTGTT
GTACACTTTCAAGCAACACTTTTTCAGACTAAAGGCCAAACAAAAGCTAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_671742	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH62083	(Get FASTA)	NCBI Sequence Viewer
	AAM90993	(Get FASTA)	NCBI Sequence Viewer
	EDM02920	(Get FASTA)	NCBI Sequence Viewer
	EDM02921	(Get FASTA)	NCBI Sequence Viewer
	F1LNI5	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_671742 ⟸ NM_147209

- UniProtKB:

Q8K3W9 (UniProtKB/TrEMBL), A0A0H2UHT5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDNETAMFSVYDGHGG
EEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAKLTTDEVIKELAQIAGRPTEDEDDK
EKVADEDDVDNEEAALLHEEATMTIEELLTRYGQNCQKGPPHTKSGTGIGDEPEPQGLNGEAGP
EDPSRETPSQENGPTAKGHTGPSSNSDHGTEAGQIGEPGTATGEAGPSCSSASDKLPRVAKSKF
FEDSEDESDEVEEEEDDSEECSEDEDGYSSEEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEEP
GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMD
GRVNGGLNLSRAIGDHFYKRNKNLPPQEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQE
VVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVELQP
ESGKRKLEEALSTEGAEENGNSDKKKAKRD

hide sequence

RefSeq Acc Id:

ENSRNOP00000029414 ⟸ ENSRNOT00000031842

Protein Domains

PPM-type phosphatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LNI5-F1-model_v2	AlphaFold	F1LNI5	1-542	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694439

Promoter ID:

EPDNEW_R4964

Type:

initiation region

Name:

Ppm1g_1

Description:

protein phosphatase, Mg2+/Mn2+ dependent, 1G

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	26,517,828 - 26,517,888	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628676	AgrOrtholog
BioCyc Gene	G2FUF-38352	BioCyc
Ensembl Genes	ENSRNOG00000026905	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000029414	ENTREZGENE
	ENSRNOP00000029414.7	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031842	ENTREZGENE
	ENSRNOT00000031842.7	UniProtKB/TrEMBL
Gene3D-CATH	3.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5599833	IMAGE-MGC_LOAD
InterPro	PP2C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PP2C_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPM-type_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPM-type_phosphatase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:259229	UniProtKB/TrEMBL
MGC_CLONE	MGC:72287	IMAGE-MGC_LOAD
NCBI Gene	259229	ENTREZGENE
PANTHER	PTHR13832	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PP2C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ppm1g	PhenoGen
PROSITE	PPM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPM_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PP2Cc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF81606	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHT5	ENTREZGENE
	F1LNI5	ENTREZGENE, UniProtKB/Swiss-Prot
	Q8K3W9	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A0H2UHT5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Ppm1g	protein phosphatase, Mg2+/Mn2+ dependent, 1G	Ppm1g	protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-02-23	Ppm1g	protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform	Ppm1g_predicted	protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (predicted)	Data Merged	737654	APPROVED
2005-01-12	Ppm1g_predicted	protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL
2003-02-27	Ppm1g	protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI