Ugdh (UDP-glucose 6-dehydrogenase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ugdh (UDP-glucose 6-dehydrogenase) Rattus norvegicus

Analyze

Symbol:

Ugdh

Name:

UDP-glucose 6-dehydrogenase

RGD ID:

621879

Description:

Enables UDP-glucose 6-dehydrogenase activity. Predicted to be involved in several processes, including UDP-glucuronate biosynthetic process; protein hexamerization; and proteoglycan biosynthetic process. Predicted to be located in nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 84. Orthologous to human UGDH (UDP-glucose 6-dehydrogenase); PARTICIPATES IN congenital sucrase-isomaltase deficiency pathway; galactokinase deficiency pathway; GALE deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

UDP-Glc dehydrogenase; UDP-GlcDH; UDP-glucose dehydrogeanse; UDP-glucose dehydrogenase; UDPGDH

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UGDH (UDP-glucose 6-dehydrogenase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ugdh (UDP-glucose dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ugdh (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UGDH (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UGDH (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ugdh (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UGDH (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UGDH (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ugdh (UDP-glucose 6-dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ACBD6 (acyl-CoA binding domain containing 6)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	UGDH (UDP-glucose 6-dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ugdh (UDP-glucose dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ugdh (UDP-glucose 6-dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sqv-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sgl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ugdh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	42,848,704 - 42,872,351 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	42,848,854 - 42,872,354 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	43,202,670 - 43,226,148 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	44,502,588 - 44,526,066 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	42,982,708 - 43,006,181 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	44,479,614 - 44,502,845 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	44,479,614 - 44,502,845 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	44,299,226 - 44,322,226 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	45,542,781 - 45,570,961 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	45,545,171 - 45,573,352 (+)	NCBI
Celera	14	41,999,555 - 42,023,022 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

developmental and epileptic encephalopathy 84 (ISO)

Generalized Epilepsy (ISO)

genetic disease (ISO)

Hyperglycinemia, Lactic Acidosis, and Seizures (ISO)

Liver Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-benzofuran (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxyethyl methacrylate (ISO)

2-methylcholine (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-fluorouracil (ISO)

9-cis-retinoic acid (ISO)

acetamide (EXP)

acrylamide (ISO)

aldrin (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bromobenzene (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium sulfate (ISO)

caffeine (ISO)

captan (ISO)

carbamazepine (EXP)

carbon nanotube (ISO)

celastrol (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

coumarin (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dichloroacetic acid (ISO)

dioxygen (EXP)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (EXP,ISO)

eugenol (ISO)

felbamate (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

fumonisin B1 (ISO)

furan (EXP,ISO)

gabapentin (EXP)

gedunin (ISO)

genistein (ISO)

gentamycin (EXP)

glyphosate (ISO)

griseofulvin (ISO)

inulin (ISO)

isoflavones (ISO)

isoprenaline (ISO)

ivermectin (ISO)

ketamine (EXP)

lead(II) chloride (ISO)

leflunomide (EXP)

mercury dichloride (EXP)

methylisothiazolinone (ISO)

methylseleninic acid (ISO)

microcystin-LR (ISO)

N-acetyl-L-cysteine (ISO)

N-ethyl-N-nitrosourea (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methylformamide (ISO)

N-nitrosodiethylamine (EXP,ISO)

naphthalene-1,5-diamine (ISO)

nefazodone (EXP)

nimesulide (EXP)

ochratoxin A (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (ISO)

phenformin (EXP)

phenobarbital (EXP,ISO)

phenytoin (EXP)

piperine (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (ISO)

pyrogallol (ISO)

quercetin (EXP)

rifampicin (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

sulforaphane (ISO)

tanespimycin (ISO)

tert-butyl ethyl ether (EXP)

tetrachloromethane (EXP,ISO)

thiabendazole (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

tolbutamide (EXP)

topotecan (EXP)

trichloroethene (EXP)

troglitazone (ISO)

tunicamycin (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate metabolic process (IEA)

chondroitin sulfate biosynthetic process (IEA,ISO,ISS)

gastrulation with mouth forming second (IEA,ISO,ISS)

glycosaminoglycan biosynthetic process (IBA)

heparan sulfate proteoglycan biosynthetic process (IEA,ISO,ISS)

neuron development (IEA,ISO,ISS)

protein hexamerization (IEA,ISO,ISS)

UDP-glucuronate biosynthetic process (IEA,ISO,ISS)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IBA)

Molecular Function

identical protein binding (IEA,ISO)

NAD binding (IEA)

UDP-glucose 6-dehydrogenase activity (IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA)

ascorbate and aldarate metabolic pathway (IEA)

congenital sucrase-isomaltase deficiency pathway (ISO)

galactokinase deficiency pathway (ISO)

GALE deficiency pathway (ISO)

glycogen storage disease type III pathway (ISO)

glycogen storage disease type IV pathway (ISO)

glycogen storage disease type VI pathway (ISO)

nucleotide sugar metabolic pathway (IEA,ISO)

pentose and glucuronate interconversion pathway (IEA)

starch and sucrose metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Characterization of human UDP-glucose dehydrogenase. CYS-276 is required for the second of two successive oxidations.	Sommer BJ, etal., J Biol Chem 2004 May 28;279(22):23590-6. Epub 2004 Mar 24.
12.	Molecular cloning and characterization of the human and mouse UDP-glucose dehydrogenase genes.	Spicer AP, etal., J Biol Chem 1998 Sep 25;273(39):25117-24.
13.	Enhancement of UDP-glucuronyltransferase, UDP-glucose dehydrogenase, and glutathione S-transferase activities in rat liver by dietary administration of eugenol.	Yokota H, etal., Biochem Pharmacol 1988 Mar 1;37(5):799-802.

Additional References at PubMed

PMID:14505572	PMID:15755804	PMID:16396499	PMID:16641100	PMID:23533145	PMID:25416956	PMID:27966912	PMID:32001716

Genomics

Comparative Map Data

Ugdh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	42,848,704 - 42,872,351 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	42,848,854 - 42,872,354 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	43,202,670 - 43,226,148 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	44,502,588 - 44,526,066 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	42,982,708 - 43,006,181 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	44,479,614 - 44,502,845 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	44,479,614 - 44,502,845 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	44,299,226 - 44,322,226 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	45,542,781 - 45,570,961 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	45,545,171 - 45,573,352 (+)	NCBI
Celera	14	41,999,555 - 42,023,022 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

UGDH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	39,498,755 - 39,527,439 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	39,498,755 - 39,528,311 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	39,500,375 - 39,529,059 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	39,176,770 - 39,205,606 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	39,322,945 - 39,351,539	NCBI
Celera	4	39,938,164 - 39,967,004 (-)	NCBI		Celera
Cytogenetic Map	4	p14	NCBI
HuRef	4	38,825,375 - 38,854,230 (-)	NCBI		HuRef
CHM1_1	4	39,499,802 - 39,528,655 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	39,468,409 - 39,497,229 (-)	NCBI		T2T-CHM13v2.0

Ugdh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	65,570,550 - 65,593,185 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	65,570,564 - 65,593,292 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	65,413,207 - 65,435,842 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	65,413,221 - 65,435,949 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	65,804,460 - 65,827,081 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	65,692,356 - 65,714,977 (-)	NCBI		MGSCv36	mm8
Celera	5	62,689,905 - 62,712,959 (-)	NCBI		Celera
Cytogenetic Map	5	C3.1	NCBI
cM Map	5	33.67	NCBI

Ugdh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	7,868,893 - 7,882,129 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955443	7,868,893 - 7,882,136 (+)	NCBI	ChiLan1.0	ChiLan1.0

UGDH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	39,880,751 - 39,909,008 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	33,827,532 - 33,856,204 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	39,679,915 - 39,708,215 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	39,681,300 - 39,708,215 (-)	Ensembl	panpan1.1		panPan2

UGDH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	72,935,532 - 72,964,151 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	72,839,920 - 72,963,208 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	75,481,824 - 75,511,112 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	73,708,348 - 73,737,653 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	73,553,586 - 73,737,645 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	72,974,965 - 73,004,279 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	73,121,242 - 73,150,553 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	73,507,747 - 73,537,066 (+)	NCBI		UU_Cfam_GSD_1.0

Ugdh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	39,179,915 - 39,207,994 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	7,089,621 - 7,118,284 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936482	7,090,241 - 7,118,315 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UGDH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	30,725,288 - 30,759,326 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	30,725,281 - 30,759,359 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	32,340,313 - 32,374,310 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UGDH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	10,781,324 - 10,810,595 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	10,781,502 - 10,810,817 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	57,174,192 - 57,202,679 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ugdh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624870	4,782,252 - 4,799,703 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624870	4,768,307 - 4,801,333 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ugdh
60 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	501
Count of miRNA genes:	247
Interacting mature miRNAs:	296
Transcripts:	ENSRNOT00000003691
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	30883777	68757901	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39998251	75582726	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat

Markers in Region

D14Got48

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	42,854,995 - 42,855,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	44,485,742 - 44,486,023	NCBI	Rnor6.0
Rnor_5.0	14	44,305,152 - 44,305,433	UniSTS	Rnor5.0
RGSC_v3.4	14	45,549,232 - 45,549,514	RGD	RGSC3.4
RGSC_v3.4	14	45,549,233 - 45,549,514	UniSTS	RGSC3.4
RGSC_v3.1	14	45,551,623 - 45,551,905	RGD
Celera	14	42,005,664 - 42,005,946	UniSTS
Cytogenetic Map	14	p11	UniSTS

RH134455

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	42,871,941 - 42,872,157 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	44,502,436 - 44,502,651	NCBI	Rnor6.0
Rnor_5.0	14	44,321,817 - 44,322,032	UniSTS	Rnor5.0
RGSC_v3.4	14	45,570,552 - 45,570,767	UniSTS	RGSC3.4
Celera	14	42,022,613 - 42,022,828	UniSTS
Cytogenetic Map	14	p11	UniSTS

RH143560

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	42,848,781 - 42,848,924 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	44,479,540 - 44,479,682	NCBI	Rnor6.0
Rnor_5.0	14	44,299,152 - 44,299,294	UniSTS	Rnor5.0
RGSC_v3.4	14	45,542,707 - 45,542,849	UniSTS	RGSC3.4
Celera	14	41,999,481 - 41,999,623	UniSTS
Cytogenetic Map	14	p11	UniSTS

BF403257

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	42,849,132 - 42,849,288 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	44,479,891 - 44,480,046	NCBI	Rnor6.0
Rnor_5.0	14	44,299,503 - 44,299,658	UniSTS	Rnor5.0
RGSC_v3.4	14	45,543,058 - 45,543,213	UniSTS	RGSC3.4
Celera	14	41,999,832 - 41,999,987	UniSTS
Cytogenetic Map	14	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	28	57	41	19	41	1	1	74	35	34	11	1
Low		15					7	10			7		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005493021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB013732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003691 ⟹ ENSRNOP00000003691

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	42,848,854 - 42,872,354 (+)	Ensembl
Rnor_6.0 Ensembl	14	44,479,614 - 44,502,845 (+)	Ensembl

RefSeq Acc Id:

NM_031325 ⟹ NP_112615

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	42,848,856 - 42,872,351 (+)	NCBI
Rnor_6.0	14	44,479,614 - 44,502,845 (+)	NCBI
Rnor_5.0	14	44,299,226 - 44,322,226 (+)	NCBI
RGSC_v3.4	14	45,542,781 - 45,570,961 (+)	RGD
Celera	14	41,999,555 - 42,023,022 (+)	RGD

Sequence:

show sequence

GGAGCGGCGGGCGGAGAGGTGTGTGGAGCTTGTGGCTTGGGAGGAAGGCGCTGTCCGAGAGAAC
GTGATCTGCGCGGCCGCTGTGTCCTGGCCTTGGAAGTGGTTCAGTCATGGTTGAGATCAAGAAG
ATCTGTTGCATTGGTGCGGGCTACGTCGGCGGACCCACATGCAGTGTCATTGCTCGCATGTGCC
CTGAAATCAGGGTAACGGTTGTGGATGTCAATGAGGCCAGGATCAATGCATGGAATTCTCCAAC
GCTTCCTATTTATGAGCCTGGACTAAAAGAAGTAGTCGAATCCTGTCGAGGGAAAAACCTCTTT
TTTTCTACCAATATTGATGATGCCATCAGAGAAGCCGATCTAGTGTTTATTTCTGTGAACACAC
CAACAAAAACATATGGAATGGGAAAAGGCCGGGCGGCAGATCTGAAGTATATCGAAGCTTGTGC
TCGCCGCATTGTGCAGAACTCAAATGGGTACAAAATTGTGACTGAGAAAAGCACAGTCCCTGTG
CGGGCAGCGGAAAGCATCCGCCGCATATTTGATGCCAACACAAAGCCCAACTTGAATCTACAGG
TTCTGTCCAATCCTGAGTTCTTGGCAGAGGGAACAGCCATCAAGGACCTAAAGAACCCAGACAG
AGTCCTGATTGGAGGGGATGAGACCCCAGAGGGCCAGAGAGCTGTTCAGGCACTCTGTGCTGTG
TACGAGCACTGGGTTCCCAAGGAAAAGATCCTCACCACCAACACTTGGTCCTCAGAGCTTTCCA
AACTGGCAGCCAATGCTTTTCTTGCCCAGAGGATCAGCAGCATTAACTCCATAAGTGCTCTGTG
TGAAAGCACAGGCGCCGATGTGGAAGAGGTGGCAACGGCTATCGGGATGGACCAAAGAATTGGA
AATAAGTTTCTAAAAGCCAGCGTTGGTTTTGGTGGGGGCTGCTTCCAAAAAGATGTTCTGAATT
TGGTTTATCTCTGTGAGGCTCTGAATCTGCCCGAAGTAGCTCGTTACTGGCAGCAGGTCATAGA
CATGAATGACTACCAGAGGAGGAGGTTTGCATCACGGATCATAGACAGCCTGTTTAATACAGTG
ACTGATAAGAAGATAGCTATCTTGGGGTTTGCGTTCAAAAAGGATACTGGTGATACCAGGGAGT
CCTCCAGTATCTACATTAGCAAATACCTGATGGACGAGGGTGCGCACCTCCACATCTACGACCC
CAAAGTACCCAGGGAGCAGATAGTGGTGGATCTTTCTCATCCAGGCGTCTCAGCGGATGACCAA
GTGTCCAGACTGGTGACCATTTCCAAGGATCCATATGAAGCATGTGATGGCGCCCATGCCCTCG
TTATCTGCACAGAGTGGGACATGTTTAAGGAACTGGATTATGAACGGATTCATAAAAGAATGCT
GAAGCCAGCCTTCATATTTGATGGCCGGCGTGTCCTGGATGGGCTCCACAATGAGCTACAGACC
ATTGGCTTCCAGATTGAAACAATTGGCAAAAAGGTATCTTCCAAGAGAATTCCATACACTCCTG
GTGAAATTCCAAAGTTTAGTCTTCAGGATCCACCTAACAAGAAGCCCAAAGTCTAGACGTCGCC
CTTTTGCCTGTGATGATTTGGTACTGCAGGGTAGCCAGCGTCTGTCTGATACTAAGTGGTAAAT
GAACTACGTGTTTTTATGGAAACAAAAATATTTTTGTAATCATCAAATTTATACTAGCTATCTG
GGTGTTAGCATATCTAGTAATTATGAGTCTAGAATAATTTTTATATATTTTTATATTATTGTAC
TCTCAGTTACTGAATGGATGGAAAACAATCATGTTGGTTTAAATGTCAGTTTTTATAAATAAAA
ATGAAACCTTGAATTTTTTAGCATTACAGGTTGTTACAGACTGCACTGTAATAACACAAGGGAA
AGGCAGTCTCATTTCCCTACCTGTTGTCTCTGCTTATCACTAAATGGGACTTCGAAGCCGTGAA
ATCACTGTGCTAGGATGGCTGATGAAGGTCTCTGGACTTTTGTTTTAATGAGATTATGTCATTA
GTGGTTTTAGTTGTCTTTGTGTCTCCCAAAACCACTCTGTCTTTCTCTCCATGCGTAACTCGGG
CAGTGCTTTCTTTTTTGAAAATTCAGCCTGAGGAGGAAATCAGTCTATGGTCTAGTTCGTCCTG
CCTCTTAGCTTCTGTACCTGCTTGTCACATTTGCACCTATGAGTCAAGATATGTTTGTTACCTT
TATTTTGATTTATTTCTATTACAATTCAATTTTTTTCCTTTAATTAAGAAAACCAATAAAGTCT
CATGTGTAAACTGG

hide sequence

RefSeq Acc Id:

XR_005493021

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	42,848,704 - 42,867,375 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112615	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA28215	(Get FASTA)	NCBI Sequence Viewer
	EDL90061	(Get FASTA)	NCBI Sequence Viewer
	EDL90062	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003691
	ENSRNOP00000003691.3
GenBank Protein	O70199	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112615 ⟸ NM_031325

- UniProtKB:

O70199 (UniProtKB/Swiss-Prot), A6JDD9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVEIKKICCIGAGYVGGPTCSVIARMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESC
RGKNLFFSTNIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTE
KSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAV
QALCAVYEHWVPKEKILTTNTWSSELSKLAANAFLAQRISSINSISALCESTGADVEEVATAIG
MDQRIGNKFLKASVGFGGGCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIID
SLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPG
VSADDQVSRLVTISKDPYEACDGAHALVICTEWDMFKELDYERIHKRMLKPAFIFDGRRVLDGL
HNELQTIGFQIETIGKKVSSKRIPYTPGEIPKFSLQDPPNKKPKV

hide sequence

RefSeq Acc Id:

ENSRNOP00000003691 ⟸ ENSRNOT00000003691

Protein Domains

UDP-glucose/GDP-mannose dehydrogenase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70199-F1-model_v2	AlphaFold	O70199	1-493	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699314

Promoter ID:

EPDNEW_R9839

Type:

multiple initiation site

Name:

Ugdh_1

Description:

UDP-glucose 6-dehydrogenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	44,479,615 - 44,479,675	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621879	AgrOrtholog
BioCyc Gene	G2FUF-15746	BioCyc
BioCyc Pathway	PWY-7346 [UDP-alpha-D-glucuronate biosynthesis (from UDP-glucose)]	BioCyc
Ensembl Genes	ENSRNOG00000002643	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000003691	ENTREZGENE
	ENSRNOT00000003691.4	UniProtKB/TrEMBL
Gene3D-CATH	Cytochrome c1, transmembrane anchor, C-terminal	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	6-PGluconate_DH-like_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-Glc/GDP-Man	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-Glc/GDP-Man_DH_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-Glc/GDP-Man_DH_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-Glc/GDP-Man_DH_dimer	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-Glc/GDP-Man_DH_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDPglc_DH_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83472	UniProtKB/Swiss-Prot
NCBI Gene	83472	ENTREZGENE
PANTHER	PTHR11374	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-GLUCOSE 6-DEHYDROGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	UDPG_MGDP_dh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDPG_MGDP_dh_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDPG_MGDP_dh_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ugdh	PhenoGen
PIRSF	UDPglc_DH_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDPglc_GDPman_dh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000002643	RatGTEx
SMART	UDPG_MGDP_dh_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48179	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF51735	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF52413	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6JDD9	ENTREZGENE, UniProtKB/TrEMBL
	A6JDE0_RAT	UniProtKB/TrEMBL
	G3V6C4_RAT	UniProtKB/TrEMBL
	O70199	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Ugdh	UDP-glucose 6-dehydrogenase	Ugdh	UDP-glucose dehydrogenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ugdh	UDP-glucose dehydrogenase		UDP-glucose dehydrogeanse	Name updated	1299863	APPROVED
2002-08-07	Ugdh	UDP-glucose dehydrogeanse			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)