Laptm5 (lysosomal protein transmembrane 5)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Laptm5 (lysosomal protein transmembrane 5) Rattus norvegicus

Analyze

Symbol:

Laptm5

Name:

lysosomal protein transmembrane 5

RGD ID:

621838

Description:

Predicted to enable protein sequestering activity; ubiquitin protein ligase binding activity; and ubiquitin-dependent protein binding activity. Predicted to be involved in several processes, including lysosomal transport; positive regulation of macromolecule metabolic process; and regulation of signal transduction. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in lysosome. Orthologous to human LAPTM5 (lysosomal protein transmembrane 5); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

gcd-10; granule cell death-10; lysosomal multispanning membrane protein 5; lysosomal-associated protein transmembrane 5; lysosomal-associated transmembrane protein 5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	143,087,759 - 143,109,807 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	143,087,759 - 143,109,807 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	145,787,261 - 145,809,419 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	147,557,078 - 147,579,236 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	147,552,786 - 147,574,739 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	149,015,793 - 149,069,719 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	149,047,681 - 149,069,719 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	152,749,594 - 152,771,632 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	149,775,904 - 149,797,951 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	149,785,942 - 149,807,990 (+)	NCBI
Celera	5	141,549,551 - 141,571,574 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

IgA glomerulonephritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dioxygen (EXP)

doxorubicin (ISO)

emodin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

flavonoids (EXP)

flutamide (EXP)

fonofos (ISO)

formaldehyde (EXP,ISO)

furan (EXP)

Genipin (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

isotretinoin (ISO)

ketamine (EXP)

lidocaine (EXP)

lipopolysaccharide (ISO)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

parathion (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

resveratrol (EXP)

rotenone (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

Soman (EXP)

sotorasib (ISO)

streptozocin (EXP)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

trametinib (ISO)

triphenyl phosphate (EXP)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity involved in apoptotic process (ISO)

cellular response to leukemia inhibitory factor (ISO)

defense response to tumor cell (ISO)

Golgi to lysosome transport (ISO)

induction of programmed cell death (ISO)

intracellular protein transport (ISO)

negative regulation of activated T cell proliferation (ISO)

negative regulation of autophagic cell death (ISO)

negative regulation of B cell activation (ISO)

negative regulation of interleukin-2 production (ISO)

negative regulation of pre-B cell receptor expression (ISO)

negative regulation of T cell activation (ISO)

negative regulation of T cell receptor signaling pathway (ISO)

negative regulation of type II interferon production (ISO)

positive regulation of cytokine production involved in immune response (ISO)

positive regulation of interleukin-12 production (ISO)

positive regulation of interleukin-6 production (ISO)

positive regulation of lysosomal membrane permeability (ISO)

positive regulation of macrophage cytokine production (ISO)

positive regulation of MAPK cascade (ISO)

positive regulation of NIK/NF-kappaB signaling (ISO)

positive regulation of protein ubiquitination (ISO)

positive regulation of proteolysis involved in protein catabolic process (ISO)

positive regulation of receptor catabolic process (ISO)

positive regulation of tumor necrosis factor-mediated signaling pathway (ISO)

positive regulation of ubiquitin-dependent protein catabolic process (ISO)

protein localization to lysosome (ISO)

protein targeting to lysosome (ISO)

Cellular Component

cytoplasmic vesicle (ISO)

cytosol (IEA)

lysosomal membrane (IBA,ISO)

lysosome (IDA,ISO)

perinuclear region of cytoplasm (ISO)

plasma membrane (ISO)

protein-containing complex (ISO)

transport vesicle (ISO)

Molecular Function

enzyme binding (ISO)

protein binding (ISO)

protein sequestering activity (ISO)

ubiquitin protein ligase binding (ISO)

ubiquitin-dependent protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	LAPTM5: a novel lysosomal-associated multispanning membrane protein preferentially expressed in hematopoietic cells.	Adra CN, etal., Genomics. 1996 Jul 15;35(2):328-37. doi: 10.1006/geno.1996.0364.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Activation of a novel microglial gene encoding a lysosomal membrane protein in response to neuronal apoptosis.	Origasa M, etal., Brain Res Mol Brain Res 2001 Mar 31;88(1-2):1-13.
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:20439489

Genomics

Comparative Map Data

Laptm5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	143,087,759 - 143,109,807 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	143,087,759 - 143,109,807 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	145,787,261 - 145,809,419 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	147,557,078 - 147,579,236 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	147,552,786 - 147,574,739 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	149,015,793 - 149,069,719 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	149,047,681 - 149,069,719 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	152,749,594 - 152,771,632 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	149,775,904 - 149,797,951 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	149,785,942 - 149,807,990 (+)	NCBI
Celera	5	141,549,551 - 141,571,574 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

LAPTM5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	30,732,469 - 30,757,774 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	30,732,469 - 30,757,774 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	31,205,316 - 31,230,621 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	30,977,903 - 31,003,254 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	30,874,408 - 30,899,760	NCBI
Celera	1	29,461,191 - 29,486,564 (-)	NCBI		Celera
Cytogenetic Map	1	p35.2	NCBI
HuRef	1	29,311,671 - 29,337,045 (-)	NCBI		HuRef
CHM1_1	1	31,321,732 - 31,347,104 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	30,584,986 - 30,610,292 (-)	NCBI		T2T-CHM13v2.0

Laptm5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	130,640,627 - 130,663,459 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	130,640,436 - 130,663,452 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	130,912,890 - 130,936,148 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	130,913,125 - 130,936,141 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	130,469,249 - 130,492,063 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	130,183,341 - 130,208,215 (+)	NCBI		MGSCv36	mm8
Celera	4	129,075,831 - 129,099,969 (+)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI

Laptm5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	9,334,587 - 9,358,444 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	9,335,481 - 9,358,177 (-)	NCBI	ChiLan1.0	ChiLan1.0

LAPTM5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	195,199,639 - 195,225,059 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	30,005,941 - 30,031,366 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	31,032,963 - 31,058,385 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	31,032,963 - 31,058,385 (-)	Ensembl	panpan1.1		panPan2

LAPTM5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	70,188,382 - 70,215,361 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	70,152,739 - 70,333,073 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	66,763,871 - 66,790,833 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	70,748,385 - 70,775,429 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	70,748,388 - 70,775,427 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	67,583,493 - 67,610,219 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	68,582,446 - 68,609,409 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	69,580,796 - 69,607,573 (+)	NCBI		UU_Cfam_GSD_1.0

Laptm5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	48,277,298 - 48,295,129 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	14,102,423 - 14,119,558 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	14,102,080 - 14,119,592 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LAPTM5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	87,363,912 - 87,390,288 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	87,363,911 - 87,390,371 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	81,068,830 - 81,095,229 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LAPTM5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	102,080,500 - 102,106,649 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	102,080,508 - 102,106,729 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	14,543,899 - 14,569,756 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Laptm5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	14,207,094 - 14,228,135 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	14,208,144 - 14,277,208 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Laptm5
254 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	308
Count of miRNA genes:	180
Interacting mature miRNAs:	214
Transcripts:	ENSRNOT00000015198
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat

Markers in Region

RH131904

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	143,108,767 - 143,108,980 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	149,068,680 - 149,068,892	NCBI	Rnor6.0
Rnor_5.0	5	152,770,593 - 152,770,805	UniSTS	Rnor5.0
RGSC_v3.4	5	149,796,912 - 149,797,124	UniSTS	RGSC3.4
Celera	5	141,570,535 - 141,570,747	UniSTS
RH 3.4 Map	5	989.6	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	8	41	31	19	31			23	11	18	11
Low		31	16	10		10	8	11	51	24	23		8
Below cutoff		4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB046592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060517	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000015198 ⟹ ENSRNOP00000015198

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	143,087,759 - 143,109,807 (+)	Ensembl
Rnor_6.0 Ensembl	5	149,047,681 - 149,069,719 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000083028 ⟹ ENSRNOP00000071739

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	143,095,524 - 143,109,807 (+)	Ensembl
Rnor_6.0 Ensembl	5	149,056,078 - 149,068,932 (+)	Ensembl

RefSeq Acc Id:

NM_053538 ⟹ NP_445990

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	143,087,759 - 143,109,807 (+)	NCBI
Rnor_6.0	5	149,047,681 - 149,069,719 (+)	NCBI
Rnor_5.0	5	152,749,594 - 152,771,632 (+)	NCBI
RGSC_v3.4	5	149,775,904 - 149,797,951 (+)	RGD
Celera	5	141,549,551 - 141,571,574 (+)	RGD

Sequence:

show sequence

GTGCACCATGGCCTCCCGTGCAGTGCCAGTCAGGCAGACATGCTGTTGTTTCAATGTCCGAGTT
GCCACCGTAGCCCTGGCCATCTACCATATAGTCATGAGCGTCTTGCTGTTCATTGAGCATGTGG
TGGAGGTGGCCCGCGGTAAAGTCTCCTGCAGGTTCTCCAAGATGCCATACCTCAGGCTGGCTGA
CCTGCTCTCCAGCTTCCTGCTCATCGGAGTCCTCTTCATTATCAGCCTCAGCCTGCTGTTCGGA
GTGGTCAAGAACCGGGAGAAGTACCTGATACCCTTCCTGTCCCTTCAAATCATGGACTTCCTGC
TGTGCCTGCTCACACTGTTGGGCTCCTACATCGAATTACCAGCATACCTGAAGTTTGCCCGGCC
CCGGCCCGGTCCTTCTAAGGTACCCTTGATGACACTGCAGCTGCTGGACTTCTGTTTGAGCATC
CTGACCCTGTGCAGCTCCTATATGGAAGTGCCCACCTACCTTAACTTCAAGTCCATGAACCACA
TGAATTACCTGCCGAGTCAGGAGGGCATGCCACGCAGCCAGTTCATCAACATGATGCTCATCTT
TTCAGTGGCCTTTATCACCGTGCTCATCCTGAAGGTCTACATGTTCAAGTGTGTTTGGACATGC
TACAGATTCATGAAGCACATGAATTCGGCCGTGGAGGACAGCAGTTCCAAGCTGTTCCTAAAGG
TGGCTCTGCCGTCCTATGAGGAAGCCTTGTCTCTGCCCACTAAGACTCCAGAGGGGGACCTTGC
ACCACCCCCATACTCGGAAGTGTGATTCCCACCAGGCTTTCAGCCCTTGGGCTGGGAGAGGCGG
AACTCCCCGCCTCCTGCTTCTTCACTTTGATGGCTGCCATGGCCTACTACAGGACAGTCTGCTT
GTGCACCCCCCCTCACTGTCCTCTCTGCTTGGGGACCTCTTACTCACAACAGAGTCACCCTGGG
CTAAATGACCCTTTGAAGCTCAGAGTACTCAGCCTAGCATCTCATCTAGTCTTCATCAGCAATG
ATACTTGTTCAGAGAACAGTCGTGGCAAATTAGGGGGAGTTTGGTTAACAACTACTGGCTTGAT
CTGTTTAGCTAGATAGCCAACACCAGCAGGGGCAGCAGGAAGAGAATCTGGCCAAGCAACAATT
CCTGGTGTCAGTCCATACTCAGCTGTCATGGGTCGTGGGTCATGGGTCATGGGTCATGGATCAT
GGGTCATGATCATGGTGCCCATTTGCTACCCCCAAGTACCCAAAAGTGTACAAATAAAACAATA
CCTTCAAATGCGTTGCTTAAACAAATACCAATCCAGCCAACCGCTGTCATTAGGCATTATGAGA
AAATCTAATAAGAAAATGAGGTGTCAAACGGGAGGGAAAGAAAAAGAAATGAAGGTCCTCCCAC
CATTCACTGTAGGGCACACCATGGACACCCTGCCCAGCCTCTGCTTGAGTTTCTCTAGCATCTG
GAGGCTGGGAAGTCCAACAGTCCTGCAACTGCCCTGAACGTTCTGCTCAGCATGGAAAAAAAAA
GTTGCTCCCGTTTTAAACAATCCTTCCCATGAGTCACCGCTCTGAGGCAAGCTGTCCTTATCTT
CAGTCAAGTGTTCCCCATAGCCACACAATGGGGAGGTTCCTGCCAGGGTCACTTTAGCCACTGG
CGGATTTAAGGTCTGGTTATCACCATGACATCCCAACAGCCAGGTTGTTCCAGCCTGTTTGCTC
AGGGCTACGCTCAGGGGGTGGCAGGCTTGGAATTGGCTGCCCTGTGGGCAGTTGTCTGTCACTA
TGTCTGTCACTATGGCTGCCTAGTTGGGGGCAGGCTAGCCCATGGGGTGTGAAGAGCCAGCCAG
AGTCTTGTGTCCCATGGTGGCAGCAAGGAGGGTCAGTCCAGGTGTCTCTGCCCACTTTCCCATT
GCTCGGGGTTCTAGGGGTTGCTAGGAATTTGCTCCTGCTTGTGGTGTAGATGGGGCTACAGGGC
TGAGAGGGCCGAGAGATGTTCCCACTGTGCCTGTGTCATTGCTTGTGTGTGACTTGGAAGAAGG
GCCAATAAAACAGCTGCAAGCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445990	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60517	(Get FASTA)	NCBI Sequence Viewer
	BAB03459	(Get FASTA)	NCBI Sequence Viewer
	EDL80601	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_445990 ⟸ NM_053538

- UniProtKB:

Q6P9Z7 (UniProtKB/TrEMBL), F1LN25 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASRAVPVRQTCCCFNVRVATVALAIYHIVMSVLLFIEHVVEVARGKVSCRFSKMPYLRLADLL
SSFLLIGVLFIISLSLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKFARPRP
GPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGMPRSQFINMMLIFSV
AFITVLILKVYMFKCVWTCYRFMKHMNSAVEDSSSKLFLKVALPSYEEALSLPTKTPEGDLAPP
PYSEV

hide sequence

RefSeq Acc Id:

ENSRNOP00000071739 ⟸ ENSRNOT00000083028

RefSeq Acc Id:

ENSRNOP00000015198 ⟸ ENSRNOT00000015198

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P9Z7-F1-model_v2	AlphaFold	Q6P9Z7	1-261	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694087

Promoter ID:

EPDNEW_R4611

Type:

initiation region

Name:

Laptm5_1

Description:

lysosomal protein transmembrane 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	149,047,621 - 149,047,681	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621838	AgrOrtholog
BioCyc Gene	G2FUF-39732	BioCyc
Ensembl Genes	ENSRNOG00000011054	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000015198	ENTREZGENE
	ENSRNOP00000015198.4	UniProtKB/TrEMBL
	ENSRNOP00000071739.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015198	ENTREZGENE
	ENSRNOT00000015198.7	UniProtKB/TrEMBL
	ENSRNOT00000083028.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5597893	IMAGE-MGC_LOAD
InterPro	LAPTM4/5	UniProtKB/TrEMBL
	LAPTM_4A/5	UniProtKB/TrEMBL
KEGG Report	rno:89783	UniProtKB/TrEMBL
MGC_CLONE	MGC:72357	IMAGE-MGC_LOAD
NCBI Gene	89783	ENTREZGENE
PANTHER	LYSOSOMAL-ASSOCIATED TRANSMEMBRANE PROTEIN	UniProtKB/TrEMBL
	PTHR12479:SF2	UniProtKB/TrEMBL
Pfam	Mtp	UniProtKB/TrEMBL
PhenoGen	Laptm5	PhenoGen
TIGRFAMs	mtp	UniProtKB/TrEMBL
UniProt	A0A0G2K184_RAT	UniProtKB/TrEMBL
	F1LN25	ENTREZGENE
	Q6P9Z7	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F1LN25	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-10-22	Laptm5	lysosomal protein transmembrane 5	Laptm5	lysosomal multispanning membrane protein 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-11	Laptm5	lysosomal multispanning membrane protein 5	Laptm5	lysosomal-associated protein transmembrane 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Laptm5	lysosomal-associated protein transmembrane 5			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Laptm5	lysosomal-associated protein transmembrane 5			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the perinuclear area of cultured microglia	633121

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD