Bambi (BMP and activin membrane-bound inhibitor)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Bambi (BMP and activin membrane-bound inhibitor) Rattus norvegicus

Analyze

Symbol:

Bambi

Name:

BMP and activin membrane-bound inhibitor

RGD ID:

621831

Description:

Predicted to enable frizzled binding activity. Involved in transforming growth factor beta receptor signaling pathway. Predicted to be located in cytoplasm and plasma membrane. Human ortholog(s) of this gene implicated in colorectal cancer. Orthologous to human BAMBI (BMP and activin membrane bound inhibitor); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; transforming growth factor-beta Smad dependent signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BMP and activin membrane-bound inhibitor homolog; BMP and activin membrane-bound inhibitor, homolog; BMP and activin membrane-bound inhibitor, homolog (Xenopus laevis); kinase-deficient TGFbeta superfamily receptor subunit

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	54,121,251 - 54,125,816 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	54,121,255 - 54,126,060 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	57,288,277 - 57,292,537 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	61,291,313 - 61,295,573 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	55,449,123 - 55,453,381 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	56,905,419 - 56,909,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	56,905,112 - 56,909,992 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	54,939,068 - 54,943,633 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	62,654,385 - 62,658,641 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	62,664,912 - 62,669,718 (-)	NCBI
Celera	17	50,102,907 - 50,107,163 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aortic valve stenosis (ISO)

Cardiomegaly (ISO)

chronic obstructive pulmonary disease (ISO)

colorectal cancer (ISO)

congestive heart failure (ISO)

genetic disease (ISO)

liver cirrhosis (ISO)

lung non-small cell carcinoma (ISO)

Lymphatic Metastasis (ISO)

obesity (ISO)

prostatitis (ISO)

Spinal Cord Injuries (IEP)

stomach cancer (ISO)

Ventricular Outflow Obstruction (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

antimycin A (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

avobenzone (ISO)

belinostat (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

boron nitride (ISO)

calciol (ISO)

cantharidin (ISO)

casticin (ISO)

CGP 52608 (ISO)

chlorogenic acid (EXP)

chloropicrin (ISO)

chloroprene (EXP)

choline (ISO)

cisplatin (EXP,ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

crocin-1 (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

cypermethrin (ISO)

D-glucose (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

diethylstilbestrol (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

folic acid (ISO)

formaldehyde (ISO)

fucoxanthin (ISO)

gentamycin (EXP)

glucose (ISO)

glyphosate (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

inulin (ISO)

irinotecan (ISO)

isoflavones (ISO)

L-methionine (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

methapyrilene (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mitomycin C (ISO)

monosodium L-glutamate (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP,ISO)

phenol (ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resorcinol (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

sotorasib (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

topotecan (EXP)

trametinib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell migration (ISO)

negative regulation of BMP signaling pathway (ISO)

negative regulation of osteoblast differentiation (ISO)

negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO)

positive regulation of canonical Wnt signaling pathway (IEA,ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of epithelial to mesenchymal transition (ISO)

regulation of cell shape (ISO)

transforming growth factor beta receptor signaling pathway (IBA,IEP)

Cellular Component

cytoplasm (ISO)

membrane (IEA)

plasma membrane (ISO)

Molecular Function

frizzled binding (IBA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Bone morphogenetic proteins signaling pathway (ISO)

transforming growth factor-beta Smad dependent signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	LPS/TLR4 Signaling Enhances TGF-β Response Through Downregulating BAMBI During Prostatic Hyperplasia.	He Y, etal., Sci Rep. 2016 May 31;6:27051. doi: 10.1038/srep27051.
4.	Expression of Bambi is widespread in juvenile and adult rat tissues and is regulated in male germ cells.	Loveland KL, etal., Endocrinology 2003 Sep;144(9):4180-6.
5.	Identification of BMP and activin membrane-bound inhibitor (BAMBI) as a potent negative regulator of adipogenesis and modulator of autocrine/paracrine adipogenic factors.	Luo X, etal., Diabetes. 2012 Jan;61(1):124-36. doi: 10.2337/db11-0998.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	[Distribution and mRNA Expression of BAMBI in Non-small-cell Lung Cancer.].	Miao S, etal., Zhongguo Fei Ai Za Zhi. 2009 Mar 20;12(3):203-7. doi: 10.3779/j.issn.1009-3419.2009.03.007.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	Prognostic significance of BMP and activin membrane-bound inhibitor in colorectal cancer.	Togo N, etal., World J Gastroenterol. 2008 Aug 21;14(31):4880-8.
14.	BAMBI (BMP and activin membrane-bound inhibitor) protects the murine heart from pressure-overload biomechanical stress by restraining TGF-β signaling.	Villar AV, etal., Biochim Biophys Acta. 2013 Feb;1832(2):323-35. doi: 10.1016/j.bbadis.2012.11.007. Epub 2012 Nov 17.
15.	BAMBI inhibits inflammation through the activation of autophagy in experimental spinal cord injury.	Yang Y, etal., Int J Mol Med. 2017 Feb;39(2):423-429. doi: 10.3892/ijmm.2016.2838. Epub 2016 Dec 27.
16.	Inhibition of BAMBI reduces the viability and motility of colon cancer via activating TGF-β/Smad pathway in vitro and in vivo.	Yu W and Chai H, Oncol Lett. 2017 Oct;14(4):4793-4799. doi: 10.3892/ol.2017.6811. Epub 2017 Aug 24.
17.	TGF-β/BAMBI pathway dysfunction contributes to peripheral Th17/Treg imbalance in chronic obstructive pulmonary disease.	Zhang JC, etal., Sci Rep. 2016 Aug 23;6:31911. doi: 10.1038/srep31911.
18.	Expression of BAMBI and its combination with Smad7 correlates with tumor invasion and poor prognosis in gastric cancer.	Zhang Y, etal., Tumour Biol. 2014 Jul;35(7):7047-56. doi: 10.1007/s13277-014-1962-5. Epub 2014 Apr 23.

Additional References at PubMed

PMID:10942595	PMID:14660579	PMID:15489334	PMID:18838381	PMID:19328798	PMID:22406377	PMID:24155898	PMID:29424488	PMID:31636010

Genomics

Comparative Map Data

Bambi
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	54,121,251 - 54,125,816 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	54,121,255 - 54,126,060 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	57,288,277 - 57,292,537 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	61,291,313 - 61,295,573 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	55,449,123 - 55,453,381 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	56,905,419 - 56,909,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	56,905,112 - 56,909,992 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	54,939,068 - 54,943,633 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	62,654,385 - 62,658,641 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	62,664,912 - 62,669,718 (-)	NCBI
Celera	17	50,102,907 - 50,107,163 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

BAMBI
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	28,677,521 - 28,682,932 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	28,677,510 - 28,682,932 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	28,966,450 - 28,971,861 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	29,006,430 - 29,011,874 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	29,006,458 - 29,011,702	NCBI
Celera	10	28,731,284 - 28,736,727 (+)	NCBI		Celera
Cytogenetic Map	10	p12.1	NCBI
HuRef	10	28,685,147 - 28,690,591 (+)	NCBI		HuRef
CHM1_1	10	28,966,877 - 28,972,320 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	28,708,908 - 28,714,318 (+)	NCBI		T2T-CHM13v2.0

Bambi
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	3,507,011 - 3,516,404 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	3,507,923 - 3,516,404 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	3,507,011 - 3,516,404 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	3,507,923 - 3,516,404 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	3,507,955 - 3,516,402 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	3,507,955 - 3,516,402 (+)	NCBI		MGSCv36	mm8
Celera	18	3,558,647 - 3,567,082 (+)	NCBI		Celera
Cytogenetic Map	18	A1	NCBI
cM Map	18	2.3	NCBI

Bambi
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	21,024,374 - 21,025,890 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955429	21,024,396 - 21,025,890 (+)	NCBI	ChiLan1.0	ChiLan1.0

BAMBI
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	10	41,359,721 - 41,364,861 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	28,833,690 - 28,839,164 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	29,187,857 - 29,193,324 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	29,187,857 - 29,193,324 (+)	Ensembl	panpan1.1		panPan2

BAMBI
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	17,453,628 - 17,459,812 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	17,455,243 - 17,462,346 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	14,952,595 - 14,958,681 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	15,700,785 - 15,706,918 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	15,700,785 - 15,710,019 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	15,139,651 - 15,145,733 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	15,026,954 - 15,033,049 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	15,300,265 - 15,306,392 (-)	NCBI		UU_Cfam_GSD_1.0

Bambi
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	8,547,962 - 8,553,293 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936613	3,098,159 - 3,103,868 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936613	3,098,549 - 3,103,868 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BAMBI
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	40,053,355 - 40,060,319 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	40,053,368 - 40,058,590 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	44,241,652 - 44,246,876 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BAMBI
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	28,279,479 - 28,284,825 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	28,279,523 - 28,285,937 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	34,317,547 - 34,323,212 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bambi
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624805	1,967,101 - 1,974,898 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624805	1,967,174 - 1,973,030 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bambi
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	40
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000021801
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	50890908	60781592	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	50890908	60781592	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	50909196	60781426	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	54029929	60463637	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		28	18	10	6	10			6	35	41	11
Low	3	15	39	31	13	31	8	11	68				8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_139082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF387513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021801 ⟹ ENSRNOP00000021801

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	54,121,255 - 54,126,060 (-)	Ensembl
Rnor_6.0 Ensembl	17	56,905,112 - 56,909,992 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105136 ⟹ ENSRNOP00000090807

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	54,121,255 - 54,124,210 (-)	Ensembl

RefSeq Acc Id:

NM_139082 ⟹ NP_620782

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	54,121,560 - 54,125,816 (-)	NCBI
Rnor_6.0	17	56,905,419 - 56,909,675 (-)	NCBI
Rnor_5.0	17	54,939,068 - 54,943,633 (-)	NCBI
RGSC_v3.4	17	62,654,385 - 62,658,641 (-)	RGD
Celera	17	50,102,907 - 50,107,163 (-)	RGD

Sequence:

show sequence

GCGGGGCGTCAATGGATCGCCACTCCAGCTACATCTTCATCTGGCTGCAGTTGGAGCTCTGCGC
CATGGCTGTGCTGCTCACCAAAGGCGAGATCAGATGCTACTGTGATGCCGCTCACTGTGTGGCA
ACTGGTTACATGTGTAAGTCCGAGCTTAGTGCCTGCTTCTCCAGACTCCTTGATCCTCAGAACA
CCAATTCCCCACTAACCCACGGCTGCCTGGACTCACTCGCAAGCACAGCAGACATCTGCCGAGC
CAAACAGGCCCAAAACCACTCTGGTCCCACCATGCCCACTTTGGAATGCTGTCATGAAGACATG
TGCAATTACCGAGGACTGCATGATGTCCTCTCTCCTCCCAAGAGTGAAGCCTCAGGACAAGGAA
ACAGATACCAGCATGACAGCAGCAGAAACCTCATCACTAAGGTGCAGGAGCTGACTTCCTCCAA
AGAACTGTGGTTCCGTGCAGCCGTGATCGCGGTTCCCATTGCTGGCGGACTGATCTTGGTGCTG
CTCATTATGTTGGCCTTGCGAATGCTGCGAAGTGAGAACAAGAGGCTGCAGGATCAGCGGCAGC
AGATGCTCTCTCGTTTGCACTACAGCTTCCATGGACACCACTCCAAGAAGGGACAGGTTGCAAA
GTTGGACTTAGAGTGCATGGTGCCCGTCAGTGGGCAGGAGAACTGCTGTCTGACCTGCGACAAA
ATGAGGCAAGCAGATCTCAGCAACGAGAAGATCCTCTCCCTTGTGCACTGGGGCATGTACAGTG
GTCATGGGAAGCTGGAATTCGTATGACAGTCGTGTCTGAACTGTAAATGGAACCCTTGAAGGCC
TTCTGAGTTC

hide sequence

RefSeq Acc Id:

XM_039096114 ⟹ XP_038952042

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	54,121,251 - 54,125,723 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_620782	(Get FASTA)	NCBI Sequence Viewer
	XP_038952042	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH70516	(Get FASTA)	NCBI Sequence Viewer
	AAK67353	(Get FASTA)	NCBI Sequence Viewer
	EDL87459	(Get FASTA)	NCBI Sequence Viewer
	Q91XN4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_620782 ⟸ NM_139082
- Peptide Label:	precursor
- UniProtKB:	Q91XN4 (UniProtKB/Swiss-Prot), A6K9G6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSP LTHGCLDSLASTADICRAKQAQNHSGPTMPTLECCHEDMCNYRGLHDVLSPPKSEASGQGNRYQ HDSSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLS RLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQADLSNEKILSLVHWGMYSGHGK LEFV hide sequence

RefSeq Acc Id:

ENSRNOP00000021801 ⟸ ENSRNOT00000021801

RefSeq Acc Id:	XP_038952042 ⟸ XM_039096114
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6ABP7 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000090807 ⟸ ENSRNOT00000105136

Protein Domains

BMP and activin membrane-bound inhibitor C-terminal BMP and activin membrane-bound inhibitor N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91XN4-F1-model_v2	AlphaFold	Q91XN4	1-260	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621831	AgrOrtholog
BioCyc Gene	G2FUF-8994	BioCyc
Ensembl Genes	ENSRNOG00000016066	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000021801	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000090807	ENTREZGENE
	ENSRNOP00000090807.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021801	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000105136	ENTREZGENE
	ENSRNOT00000105136.1	UniProtKB/TrEMBL
Gene3D-CATH	2.10.60.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100920	IMAGE-MGC_LOAD
InterPro	BAMBI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BAMBI_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BAMBI_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Snake_toxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83837	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91477	IMAGE-MGC_LOAD
NCBI Gene	83837	ENTREZGENE
PANTHER	PTHR15505:SF1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RIIA DOMAIN-CONTAINING PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	BAMBI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BAMBI_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Bambi	PhenoGen
PIRSF	BAMBI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF57302	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6ABP7	ENTREZGENE, UniProtKB/TrEMBL
	A6K9G6	ENTREZGENE, UniProtKB/TrEMBL
	BAMBI_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-07-31	Bambi	BMP and activin membrane-bound inhibitor	Bambi	BMP and activin membrane-bound inhibitor, homolog (Xenopus laevis)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Bambi	BMP and activin membrane-bound inhibitor, homolog (Xenopus laevis)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Bambi	BMP and activin membrane-bound inhibitor, homolog (Xenopus laevis)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in granulosa and thecal cells of adult ovaries, in spermatogonia, spermatocytes, round spermatids, and Sertoli cells of adult testes	632261
gene_homology	89% (nucleic acid) and 95% (amino acid) identical to human homolog	632261

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)