Hsd17b2 (hydroxysteroid (17-beta) dehydrogenase 2)

Advanced Search (OLGA)

Gene: Hsd17b2 (hydroxysteroid (17-beta) dehydrogenase 2) Rattus norvegicus

Analyze

Symbol:

Hsd17b2

Name:

hydroxysteroid (17-beta) dehydrogenase 2

RGD ID:

621803

Description:

Enables estradiol 17-beta-dehydrogenase [NAD(P)+] activity and testosterone dehydrogenase (NAD+) activity. Involved in bone development; cellular response to metal ion; and steroid hormone biosynthetic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in intracellular membrane-bounded organelle. Orthologous to human HSD17B2 (hydroxysteroid 17-beta dehydrogenase 2); PARTICIPATES IN estradiol biosynthetic pathway; testosterone biosynthetic pathway; steroid hormone biosynthetic pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

17-beta hydroxysteroid dehydrogenase type 2; 17-beta-HSD 2; 17-beta-hydroxysteroid dehydrogenase 2; 17-beta-hydroxysteroid dehydrogenase type 2; estradiol 17-beta-dehydrogenase 2; testosterone 17-beta-dehydrogenase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	62,662,320 - 62,733,944 (+)	NCBI		GRCr8
mRatBN7.2	19	45,753,576 - 45,825,203 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	45,753,574 - 45,825,202 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	52,565,001 - 52,636,759 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	53,216,191 - 53,287,955 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	55,460,429 - 55,532,204 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	50,246,404 - 50,317,892 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	50,246,402 - 50,317,891 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	61,033,236 - 61,101,461 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	47,729,519 - 47,802,933 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	47,734,400 - 47,807,814 (-)	NCBI
Celera	19	45,023,173 - 45,093,239 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Endometrial Neoplasms (ISO)

endometriosis (ISO)

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2-amino-4,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methoxy-17beta-estradiol (ISO)

2-methoxyestrone (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,4-dichloroaniline (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

8-Br-cAMP (ISO)

acetoacetyl-CoA (ISO)

aflatoxin B1 (ISO)

aldrin (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

androst-4-ene-3,17-dione (ISO)

androst-5-ene-3beta,17beta-diol (ISO)

antimony(0) (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

bromuconazole (EXP)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlorpyrifos (EXP,ISO)

chromium(6+) (EXP,ISO)

cisplatin (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP,ISO)

dehydroepiandrosterone (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dienogest (ISO)

diethyl maleate (EXP)

dioxygen (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diquat (ISO)

diuron (EXP,ISO)

dydrogesterone (ISO)

endosulfan (EXP)

epoxiconazole (EXP)

estrone (ISO)

fenvalerate (EXP)

fipronil (EXP)

furan (EXP)

genistein (ISO)

glafenine (EXP)

glyphosate (EXP)

graphite (EXP)

hexachlorobenzene (EXP)

hydrogen peroxide (ISO)

hydroquinone (ISO)

imidacloprid (EXP)

ketoconazole (ISO)

L-ascorbic acid (EXP)

lead diacetate (ISO)

leflunomide (ISO)

medroxyprogesterone acetate (ISO)

mercury dichloride (EXP)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP,ISO)

NAD zwitterion (ISO)

NAD(+) (ISO)

nevirapine (EXP)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

PD 0325901 (ISO)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenformin (EXP)

phenobarbital (EXP,ISO)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

prochloraz (EXP)

progesterone (ISO)

promegestone (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (EXP)

rotenone (EXP)

sevoflurane (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thiabendazole (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

triadimefon (ISO)

triphenyl phosphate (EXP)

troglitazone (EXP)

valproic acid (EXP)

zearalenone (EXP)

zinc atom (EXP)

zinc(0) (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

androgen biosynthetic process (IDA)

androgen metabolic process (IEA,ISO)

bone development (IEP)

cellular response to metal ion (IEP)

estrogen biosynthetic process (IDA,IEA,ISO)

in utero embryonic development (IEA,ISO)

placenta development (IEA,ISO)

response to retinoic acid (IEA,ISO)

steroid metabolic process (IBA)

Cellular Component

endoplasmic reticulum membrane (IEA,ISO,ISS)

intracellular membrane-bounded organelle (IBA)

Molecular Function

estradiol 17-beta-dehydrogenase [NAD(P)+] activity (IBA,IDA,IEA,ISO)

protein binding (ISO)

testosterone dehydrogenase (NAD+) activity (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

estradiol biosynthetic pathway (ISO)

steroid hormone biosynthetic pathway (IEA)

testosterone biosynthetic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning of rat 17 beta-hydroxysteroid dehydrogenase type 2 and characterization of tissue distribution and catalytic activity of rat type 1 and type 2 enzymes.	Akinola LA, etal., Endocrinology 1996 May;137(5):1572-9.
2.	Lactational exposure to hexavalent chromium delays puberty by impairing ovarian development, steroidogenesis and pituitary hormone synthesis in developing Wistar rats.	Banu SK, etal., Toxicol Appl Pharmacol. 2008 Oct 15;232(2):180-9. Epub 2008 Jun 17.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Aging reduces the efficacy of estrogen substitution to attenuate cardiac hypertrophy in female spontaneously hypertensive rats.	Jazbutyte V, etal., Hypertension. 2006 Oct;48(4):579-86. Epub 2006 Aug 28.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.	Payne AH and Hales DB, Endocr Rev. 2004 Dec;25(6):947-70.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Expression of estrogen receptors and enzymes involved in sex steroid metabolism in the rat tibia during sexual maturation.	van der Eerden BC, etal., J Endocrinol. 2004 Mar;180(3):457-67.

Additional References at PubMed

PMID:8099587	PMID:12477932	PMID:17538076	PMID:18048640	PMID:22837477

Genomics

Comparative Map Data

Hsd17b2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	62,662,320 - 62,733,944 (+)	NCBI		GRCr8
mRatBN7.2	19	45,753,576 - 45,825,203 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	45,753,574 - 45,825,202 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	52,565,001 - 52,636,759 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	53,216,191 - 53,287,955 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	55,460,429 - 55,532,204 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	50,246,404 - 50,317,892 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	50,246,402 - 50,317,891 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	61,033,236 - 61,101,461 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	47,729,519 - 47,802,933 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	47,734,400 - 47,807,814 (-)	NCBI
Celera	19	45,023,173 - 45,093,239 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

HSD17B2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	82,035,253 - 82,098,534 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	82,035,004 - 82,098,534 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	82,068,858 - 82,132,139 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	80,626,364 - 80,689,638 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	80,626,363 - 80,689,638	NCBI
Celera	16	66,367,527 - 66,430,804 (+)	NCBI		Celera
Cytogenetic Map	16	q23.3	NCBI
HuRef	16	67,822,411 - 67,885,688 (+)	NCBI		HuRef
CHM1_1	16	83,480,225 - 83,543,515 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	88,098,974 - 88,162,234 (+)	NCBI		T2T-CHM13v2.0

Hsd17b2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	118,427,752 - 118,485,767 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	118,428,643 - 118,485,766 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	117,700,982 - 117,759,030 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	117,701,904 - 117,759,027 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	120,225,846 - 120,282,929 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	120,587,962 - 120,644,851 (+)	NCBI		MGSCv36	mm8
Celera	8	121,922,376 - 121,979,885 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	64.82	NCBI

Hsd17b2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955564	1,922,703 - 1,983,966 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955564	1,884,235 - 1,984,182 (-)	NCBI	ChiLan1.0	ChiLan1.0

HSD17B2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	91,785,636 - 91,848,535 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	97,705,141 - 97,768,166 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	62,642,316 - 62,705,261 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	82,062,047 - 82,125,039 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	82,062,042 - 82,125,139 (+)	Ensembl	panpan1.1		panPan2

HSD17B2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	69,927,888 - 70,009,306 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	69,927,984 - 70,009,179 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	69,936,380 - 70,023,461 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	70,226,818 - 70,314,083 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	70,232,641 - 70,314,177 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	70,169,271 - 70,257,042 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	70,005,963 - 70,093,190 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	70,423,292 - 70,510,487 (-)	NCBI		UU_Cfam_GSD_1.0

Hsd17b2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	30,094,893 - 30,162,355 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	29,426,883 - 29,494,225 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	29,426,922 - 29,494,215 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HSD17B2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	6,292,707 - 6,360,633 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	6,296,429 - 6,360,434 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	6,885,015 - 6,885,284 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HSD17B2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	67,464,986 - 67,529,079 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	67,464,334 - 67,529,182 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	8,304,938 - 8,368,998 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hsd17b2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	5,368,142 - 5,446,429 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	5,372,176 - 5,445,726 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hsd17b2
356 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	63
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000018795
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	44340214	55283277	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat

Markers in Region

RH129256

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	45,824,987 - 45,825,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	50,317,677 - 50,317,869	NCBI	Rnor6.0
Rnor_5.0	19	61,101,246 - 61,101,438	UniSTS	Rnor5.0
RGSC_v3.4	19	47,729,542 - 47,729,734	UniSTS	RGSC3.4
Celera	19	45,093,024 - 45,093,216	UniSTS
RH 3.4 Map	19	610.4	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	17	65	86	90	59	24	59	6	173	54	50	45	55	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X91234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018795 ⟹ ENSRNOP00000018795

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	45,753,574 - 45,825,202 (+)	Ensembl
Rnor_6.0 Ensembl	19	50,246,402 - 50,317,891 (+)	Ensembl

RefSeq Acc Id:

NM_024391 ⟹ NP_077367

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,662,320 - 62,733,944 (+)	NCBI
mRatBN7.2	19	45,753,576 - 45,825,203 (+)	NCBI
Rnor_6.0	19	50,246,404 - 50,317,892 (+)	NCBI
Rnor_5.0	19	61,033,236 - 61,101,461 (+)	NCBI
RGSC_v3.4	19	47,729,519 - 47,802,933 (-)	RGD
Celera	19	45,023,173 - 45,093,239 (+)	RGD

Sequence:

show sequence

CGCGGCCGCTTCTCACTGGCCCAGAGCAAGTGAAGACCAGTGGAGAATGAACCCGTTTTCCTCT
GAGTCAGCATGGCTCTGCTTGACTGCCACTGCGGTGCTGGGGGGCATGCTTCTCTGCAAAGCCT
GGAGTTCAGGGCAGCTAAGGAGCCAGGTGGTGTGTCTGGCTGGCCTCTGGGGAGGTGCCTGCCT
GCTCAGCCTGTCCCTCCTCTGCAGCTTGTTCCTCTTATCGGTGTCCTGCTTCTTCCTTCTGTAT
GTGAGTTCATCTGACCAAGACTTGTTACCTGTGGATCAAAAGGCTGTGCTGGTGACAGGTGCCG
ATTCCGGTTTCGGTCATGCTTTGGCCAAGCACCTGGACAAGCTGGGTTTCACAGTGTTTGCTGG
AGTGCTGGATAAAGAGGGCCCAGGAGCGGAGGAATTGAGGAAAAACTGCTCTGAGCGCCTTTCG
GTGCTCCAGATGGATGTCACCAAGCCAGAGCAGATAAAAGATGTTCACAGCGAAGTCGCAGAGA
AGATACAAGACAAAGGACTGTGGGCTGTGGTCAACAATGCTGGGGTCTTGCACTTTCCGATCGA
CGGGGAACTCATTCCCATGACCGTGTACAGAAAATGCATGGCAGTGAACTTCTTCGGAGCCGTC
GAGGTCACCAAGGTGTTTCTGCCTCTACTTAGAAAGTCCAAGGGGAGGCTGGTTAACGTCAGCA
GCATGGGAGCCATGATTCCATTTCAGATGGTGGCCGCCTACGCCTCCACGAAGGCAGCTATAAG
CATGTTCTCAGCCGTCATCAGGCAAGAGCTTGCCAAATGGGGAGTCAAAGTCGTGACCATCCAT
CCTGGAGGCTTCCAAACAAACATCGTAGGCTCACAGGACAGTTGGGATAAAATGGAGAAGGAGA
TCCTGGACCACTTTTCCAAAGAGATTCAGGAGAACTATGGACAGGAATATGTCCATACGCAGAA
GCTCGCCCTCCCGGTCATGAGAGAGATGTCCAACCCGGATATCACCCCTGTGCTGCGGGACATC
CAGCACGCCATTTGTGCCAAGAACCCCTCTTCCTTTTATTGCTCAGGGAGAATGACTTACCTGT
GGATCTGCTTCGCGGCCTACTCCCCGATCAGCTTATTGGACTATATTTTGAAAAACTATTTTAC
TCCAAAACTCATGCCAAGAGCTTTAAGGACAGCAAGTTAGAAGAACAAGGGCCCGGGTAGGGTG
GGAAATGCCACATGCTTAGGATGAAAGGGAAACCTCTTATTAAACTAACTTTCTACCTCAAAAA
AAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077367	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88134	(Get FASTA)	NCBI Sequence Viewer
	CAA62617	(Get FASTA)	NCBI Sequence Viewer
	EDL92656	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018795.2
	ENSRNOP00055030724
	ENSRNOP00060033910
	ENSRNOP00065007084
GenBank Protein	Q62730	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_077367 ⟸ NM_024391

- UniProtKB:

Q62730 (UniProtKB/Swiss-Prot), Q5I0N4 (UniProtKB/TrEMBL), F7EZ71 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNPFSSESAWLCLTATAVLGGMLLCKAWSSGQLRSQVVCLAGLWGGACLLSLSLLCSLFLLSVS
CFFLLYVSSSDQDLLPVDQKAVLVTGADSGFGHALAKHLDKLGFTVFAGVLDKEGPGAEELRKN
CSERLSVLQMDVTKPEQIKDVHSEVAEKIQDKGLWAVVNNAGVLHFPIDGELIPMTVYRKCMAV
NFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAMIPFQMVAAYASTKAAISMFSAVIRQELAKWGV
KVVTIHPGGFQTNIVGSQDSWDKMEKEILDHFSKEIQENYGQEYVHTQKLALPVMREMSNPDIT
PVLRDIQHAICAKNPSSFYCSGRMTYLWICFAAYSPISLLDYILKNYFTPKLMPRALRTAS

hide sequence

Ensembl Acc Id:

ENSRNOP00000018795 ⟸ ENSRNOT00000018795

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62730-F1-model_v2	AlphaFold	Q62730	1-381	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701173

Promoter ID:

EPDNEW_R11696

Type:

single initiation site

Name:

Hsd17b2_1

Description:

hydroxysteroid (17-beta) dehydrogenase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	50,246,395 - 50,246,455	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621803	AgrOrtholog
BioCyc Gene	G2FUF-5537	BioCyc
Ensembl Genes	ENSRNOG00000013982	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055021964	UniProtKB/Swiss-Prot
	ENSRNOG00060023663	UniProtKB/Swiss-Prot
	ENSRNOG00065006369	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018795.4	UniProtKB/TrEMBL
	ENSRNOT00055037681	UniProtKB/Swiss-Prot
	ENSRNOT00060040976	UniProtKB/Swiss-Prot
	ENSRNOT00065009780	UniProtKB/Swiss-Prot
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7326035	IMAGE-MGC_LOAD
InterPro	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sc_DH/Rdtase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SDR_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79243	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108672	IMAGE-MGC_LOAD
NCBI Gene	79243	ENTREZGENE
PANTHER	17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY 9C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	adh_short	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hsd17b2	PhenoGen
PRINTS	GDHRDH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SDRFAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ADH_SHORT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013982	RatGTEx
	ENSRNOG00055021964	RatGTEx
	ENSRNOG00060023663	RatGTEx
	ENSRNOG00065006369	RatGTEx
Superfamily-SCOP	SSF51735	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	DHB2_RAT	UniProtKB/Swiss-Prot
	F7EZ71	ENTREZGENE, UniProtKB/TrEMBL
	Q5I0N4	ENTREZGENE, UniProtKB/TrEMBL
	Q62730	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Hsd17b2	hydroxysteroid (17-beta) dehydrogenase 2		17-beta hydroxysteroid dehydrogenase type 2	Name updated	1299863	APPROVED
2002-08-07	Hsd17b2	17-beta hydroxysteroid dehydrogenase type 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	converts estradiol to estrone and testosterone into androstenedione	728619
gene_function	appears to oxidize 17-betahydroxysteroids into their relatively inactive keto derivatives	728619
gene_homology	protein shares 77% similarity and 62% identity with human homolog	728619
gene_protein	protein has predicted mass of 42 kDa	728619

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)