Advanced Search (OLGA)

Gene: Acvr1c (activin A receptor type 1C) Rattus norvegicus

Analyze

Symbol:

Acvr1c

Name:

activin A receptor type 1C

RGD ID:

621789

Description:

Enables several functions, including ATP binding activity; BMP receptor binding activity; and activin binding activity. Involved in several processes, including brain development; cell surface receptor protein serine/threonine kinase signaling pathway; and response to aldosterone. Located in cell surface. Part of activin receptor complex. Biomarker of retinal degeneration. Orthologous to human ACVR1C (activin A receptor type 1C); PARTICIPATES IN transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 2,4-dinitrotoluene; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

activin A receptor, type IC; activin receptor type IC; activin receptor type-1C; activin receptor-like kinase 7; ACTR-IC; Alk-7; Alk7; habrec1; TGF-beta type 1 receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACVR1C (activin A receptor type 1C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Acvr1c (activin A receptor, type IC)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Acvr1c (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACVR1C (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACVR1C (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acvr1c (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACVR1C (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACVR1C (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acvr1c (activin A receptor type 1C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NEUROG1 (neurogenin 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ACVR1C (activin A receptor type 1C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Acvr1c (activin A receptor, type IC)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	babo	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	daf-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acvr1c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	63,224,322 - 63,301,252 (-)	NCBI		GRCr8
mRatBN7.2	3	42,815,490 - 42,892,423 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	42,822,610 - 42,892,327 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	46,155,042 - 46,224,767 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	54,750,410 - 54,820,131 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	52,529,199 - 52,598,998 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	44,272,859 - 44,342,501 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	44,270,653 - 44,342,355 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	49,392,012 - 49,462,621 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	40,027,228 - 40,102,303 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	39,923,599 - 39,998,675 (-)	NCBI
Celera	3	40,890,441 - 40,959,920 (-)	NCBI		Celera
Cytogenetic Map	3	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

retinal degeneration (IEP)

RETINAL DYSTROPHY WITH INNER RETINAL DYSFUNCTION AND GANGLION CELL ABNORMALITIES (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (ISO)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3,4-dichloroaniline (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

aldrin (ISO)

amitrole (EXP)

ammonium chloride (EXP)

benzene (EXP)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

carboplatin (ISO)

choline (ISO)

cisplatin (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

DDD (ISO)

DDE (ISO)

dexamethasone (ISO)

diazinon (EXP)

Dibutyl phosphate (ISO)

dieldrin (ISO)

diuron (ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (ISO)

fonofos (ISO)

furan (EXP)

gamma-hexachlorocyclohexane (EXP)

glycidol (EXP)

gold atom (ISO)

gold(0) (ISO)

indometacin (ISO)

itraconazole (ISO)

ketamine (EXP)

L-methionine (ISO)

lead(0) (ISO)

melphalan (ISO)

methimazole (EXP)

methylmercury(1+) (EXP)

nickel atom (ISO)

ozone (ISO)

parathion (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

terbufos (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activin receptor signaling pathway (IBA,IDA)

apoptotic nuclear changes (IEA,ISO)

apoptotic process (IEA)

apoptotic signaling pathway (IEA,IMP,ISO)

cell differentiation (IDA,IEA,ISO)

cell surface receptor protein serine/threonine kinase signaling pathway (IEA)

cellular response to growth factor stimulus (IBA)

cerebellum development (IEP)

determination of left/right symmetry (ISO)

hippocampus development (IEP)

in utero embryonic development (ISO)

insulin secretion (IEA,ISO)

lipid storage (IEA,ISO)

midbrain development (IEP)

negative regulation of chorionic trophoblast cell proliferation (IEA,ISO)

negative regulation of insulin secretion (IEA,ISO)

negative regulation of trophoblast cell migration (IEA,ISO)

nervous system development (IBA)

nodal signaling pathway (IEA,ISO)

ovarian follicle development (IEP)

positive regulation of apoptotic process (IEA,ISO)

protein phosphorylation (IC)

regulation of apoptotic process (IDA)

response to aldosterone (IEP)

response to dietary excess (IEA,ISO)

response to glucose (IEA,IEP,ISO)

response to insulin (IEA,ISO)

response to lipid (IEP)

response to xenobiotic stimulus (IEP)

SMAD protein signal transduction (IGI)

transforming growth factor beta receptor complex assembly (IDA)

trophectodermal cell proliferation (IEA,ISO)

Cellular Component

activin receptor complex (IBA,IDA,IEA,ISO)

cell surface (IDA)

membrane (IEA)

plasma membrane (IBA)

Molecular Function

activin binding (IDA)

activin receptor activity (IDA,IEA,IMP,ISO)

activin receptor activity, type I (IBA,IDA,IEA,ISO)

ATP binding (IDA,IEA)

BMP receptor binding (IDA)

growth factor binding (IEA,ISO,ISS)

kinase activity (IEA)

metal ion binding (IC,IEA)

nodal binding (IEA,ISO)

nucleotide binding (IEA)

protein kinase activity (IEA)

protein serine/threonine kinase activity (IDA,IEA)

SMAD binding (IDA)

transferase activity (IEA)

transmembrane receptor protein serine/threonine kinase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	SB-431542 is a potent and specific inhibitor of transforming growth factor-beta superfamily type I activin receptor-like kinase (ALK) receptors ALK4, ALK5, and ALK7.	Inman GJ, etal., Mol Pharmacol. 2002 Jul;62(1):65-74.
4.	The orphan receptor serine/threonine kinase ALK7 signals arrest of proliferation and morphological differentiation in a neuronal cell line.	Jornvall H, etal., J Biol Chem. 2001 Feb 16;276(7):5140-6. Epub 2000 Nov 17.
5.	Activin receptor-like kinase-7 induces apoptosis through activation of MAPKs in a Smad3-dependent mechanism in hepatoma cells.	Kim BC, etal., J Biol Chem. 2004 Jul 2;279(27):28458-65. doi: 10.1074/jbc.M313277200. Epub 2004 Apr 23.
6.	Habrec1, a novel serine/threonine kinase TGF-beta type I-like receptor, has a specific cellular expression suggesting function in the developing organism and adult brain.	Lorentzon M, etal., Exp Neurol. 1996 Dec;142(2):351-60.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Gene expression changes in the retina after systemic administration of aldosterone.	Ono A, etal., Jpn J Ophthalmol. 2018 Jul;62(4):499-507. doi: 10.1007/s10384-018-0595-4. Epub 2018 Apr 30.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	A novel type I receptor serine-threonine kinase predominantly expressed in the adult central nervous system.	Ryden M, etal., J Biol Chem 1996 Nov 29;271(48):30603-9.
14.	Activin isoforms signal through type I receptor serine/threonine kinase ALK7.	Tsuchida K, etal., Mol Cell Endocrinol. 2004 May 31;220(1-2):59-65.
15.	Molecular cloning of a novel type I receptor serine/threonine kinase for the TGF beta superfamily from rat brain.	Tsuchida K, etal., Mol Cell Neurosci 1996 Jun;7(6):467-78.
16.	Role and regulation of nodal/activin receptor-like kinase 7 signaling pathway in the control of ovarian follicular atresia.	Wang H, etal., Mol Endocrinol. 2006 Oct;20(10):2469-82. Epub 2006 May 18.
17.	Activin receptor-like kinase 7 induces apoptosis of pancreatic beta cells and beta cell lines.	Zhang N, etal., Diabetologia. 2006 Mar;49(3):506-18. Epub 2006 Jan 27.

Additional References at PubMed

PMID:9920806	PMID:12063393	PMID:15150278	PMID:15485907	PMID:15531507	PMID:18480258	PMID:18480259	PMID:21356369	PMID:21805089	PMID:22550067	PMID:25577243	PMID:35666032

Genomics

Comparative Map Data

Acvr1c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	63,224,322 - 63,301,252 (-)	NCBI		GRCr8
mRatBN7.2	3	42,815,490 - 42,892,423 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	42,822,610 - 42,892,327 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	46,155,042 - 46,224,767 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	54,750,410 - 54,820,131 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	52,529,199 - 52,598,998 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	44,272,859 - 44,342,501 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	44,270,653 - 44,342,355 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	49,392,012 - 49,462,621 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	40,027,228 - 40,102,303 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	39,923,599 - 39,998,675 (-)	NCBI
Celera	3	40,890,441 - 40,959,920 (-)	NCBI		Celera
Cytogenetic Map	3	q21	NCBI

ACVR1C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	157,526,767 - 157,628,864 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	157,526,767 - 157,628,864 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	158,383,279 - 158,485,376 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	158,097,150 - 158,193,645 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	158,214,411 - 158,310,902	NCBI
Celera	2	151,996,398 - 152,098,507 (-)	NCBI		Celera
Cytogenetic Map	2	q24.1	NCBI
HuRef	2	150,268,922 - 150,370,677 (-)	NCBI		HuRef
CHM1_1	2	158,389,261 - 158,491,360 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	157,980,200 - 158,081,964 (-)	NCBI		T2T-CHM13v2.0

Acvr1c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	58,157,465 - 58,247,909 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	58,157,465 - 58,247,907 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	58,267,453 - 58,357,896 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	58,267,453 - 58,357,895 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	58,119,864 - 58,210,169 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	58,087,208 - 58,140,193 (-)	NCBI		MGSCv36	mm8
Celera	2	60,022,538 - 60,113,847 (-)	NCBI		Celera
Cytogenetic Map	2	C1.1	NCBI
cM Map	2	33.05	NCBI

Acvr1c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	15,813,856 - 15,858,537 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955449	15,814,230 - 15,864,747 (+)	NCBI	ChiLan1.0	ChiLan1.0

ACVR1C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	60,191,507 - 60,289,620 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	60,206,482 - 60,304,587 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	44,785,808 - 44,883,977 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	162,027,016 - 162,080,583 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	162,034,161 - 162,124,151 (-)	Ensembl	panpan1.1		panPan2

ACVR1C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	3,534,231 - 3,583,310 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	3,541,248 - 3,613,384 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	3,671,176 - 3,750,547 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	3,656,388 - 3,735,771 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	3,662,294 - 3,736,109 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	3,658,544 - 3,737,821 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	3,718,246 - 3,797,628 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	3,756,338 - 3,835,686 (-)	NCBI		UU_Cfam_GSD_1.0

Acvr1c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	120,653,036 - 120,725,005 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	20,892,466 - 20,960,098 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	20,892,715 - 20,964,674 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACVR1C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	64,455,989 - 64,529,107 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	64,452,632 - 64,529,329 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	71,381,954 - 71,455,690 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACVR1C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	42,935,085 - 43,030,581 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	42,942,284 - 42,994,488 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	156,542,844 - 156,643,373 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acvr1c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	8,130,962 - 8,247,289 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624732	8,130,970 - 8,247,528 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Acvr1c
342 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	40
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000059280
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	27494621	44188411	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
10450816	Scl75	Serum cholesterol level QTL 75	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	38192233	50749747	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	27494621	50302886	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	27494621	50302886	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
10450852	Stl33	Serum triglyceride level QTL 33	3.4	0.05	blood LDL triglyceride amount (VT:0010699)	blood lipoprotein triglyceride level (CMO:0002685)	3	38192233	50749747	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
4889975	Bmd81	Bone mineral density QTL 81	4.3		tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	38710365	50302886	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
634317	Bw117	Body weight QTL 117	3.58		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	39454637	53296578	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	27494621	50302886	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
10450813	Scl74	Serum cholesterol level QTL 74	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	38192233	50749747	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat

Markers in Region

BE118782

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	42,860,767 - 42,860,923 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	44,310,935 - 44,311,090	NCBI	Rnor6.0
Rnor_5.0	3	49,431,376 - 49,431,531	UniSTS	Rnor5.0
RGSC_v3.4	3	40,067,971 - 40,068,126	UniSTS	RGSC3.4
Celera	3	40,928,507 - 40,928,662	UniSTS
RH 3.4 Map	3	555.5	UniSTS
Cytogenetic Map	3	q21	UniSTS

BF390693

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	42,834,749 - 42,834,906 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	44,285,018 - 44,285,174	NCBI	Rnor6.0
Rnor_5.0	3	49,404,375 - 49,404,531	UniSTS	Rnor5.0
RGSC_v3.4	3	40,039,286 - 40,039,442	UniSTS	RGSC3.4
Celera	3	40,902,581 - 40,902,737	UniSTS
RH 3.4 Map	3	556.4	UniSTS
Cytogenetic Map	3	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	46	105	91	90	59	22	59	6	210	89	85	45	57	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_139090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U35025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U63318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U69702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000059280 ⟹ ENSRNOP00000056047

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	42,822,610 - 42,892,327 (-)	Ensembl
Rnor_6.0 Ensembl	3	44,270,653 - 44,342,355 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099861 ⟹ ENSRNOP00000088735

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	42,822,610 - 42,892,327 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101769 ⟹ ENSRNOP00000083168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	42,822,610 - 42,892,327 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107627 ⟹ ENSRNOP00000094234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	42,822,610 - 42,862,166 (-)	Ensembl

RefSeq Acc Id:

NM_139090 ⟹ NP_620790

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	63,231,442 - 63,301,154 (-)	NCBI
mRatBN7.2	3	42,822,610 - 42,892,327 (-)	NCBI
Rnor_6.0	3	44,272,859 - 44,342,501 (-)	NCBI
Rnor_5.0	3	49,392,012 - 49,462,621 (-)	NCBI
RGSC_v3.4	3	40,027,228 - 40,102,303 (-)	RGD
Celera	3	40,890,441 - 40,959,920 (-)	RGD

Sequence:

show sequence

GGGAGGCCCCGCTGCCACTAGAGCCAACCGCGCACTTCCGAAGGTGTCGCGGCTGGCCTCCCCT
CCCGCCGCCCCGGGAACTTCAAAGCGGCCCGCGCTGCGTGCCGCTCTGGGACCCCGAAGCCTTG
CACCGCCGCGGGGTGGCCATGACCCCAGCAAGCCGCTCCGCACTGAGCCTGGCCCTCCTGCTGG
TGGCACTGGCCTCCGACCTTGCGGCAGGACTGAAGTGTGTGTGTCTTTTGTGTGATTCCTCAAA
CTTTACCTGCCAAACCGAAGGAGCATGCTGGGCCTCTGTCATGCTAACCAACGGGAAAGAACAG
GTGATCAAATCGTGCGTGTCCCTCCCGGAACTAAATGCTCAGGTCTTCTGTCACAGTTCCAACA
ACGTGACCAAGACCGAATGTTGCTTCACAGACTTCTGCAACAACATCACTCTGCACCTTCCCAC
AGCATCTCCAGATGCCCCTAGACTTGGCCCCACAGAGCTGACAGTTGTTATCACTGTACCTGTT
TGCCTCCTGTCCATCGCAGCCATGCTAACGATATGGGCCTGCCAGGACCGCCAGTGCACATACA
GGAAGACCAAGAGACACAATGTGGAGGAACCACTGGCAGAGTACAGCCTTGTCAATGCTGGAAA
AACCCTCAAAGATCTGATTTATGATGCCACTGCCTCGGGCTCAGGATCTGGCCTGCCTCTTTTG
GTTCAAAGAACCATCGCAAGGACAATTGTACTTCAAGAAATCGTAGGAAAAGGTCGGTTTGGGG
AAGTGTGGCACGGAAGATGGTGTGGAGAAGATGTGGCTGTGAAAATATTCTCCTCCAGAGATGA
GAGATCTTGGTTCCGTGAGGCAGAAATTTATCAGACGGTAATGCTGAGACATGAGAATATTCTC
GGTTTCATCGCGGCCGACAACAAAGATAATGGAACCTGGACTCAGCTTTGGCTTGTGTCAGAGT
ATCACGAGCAGGGCTCCTTATATGACTATTTGAATAGAAACATAGTGACCGTGGCTGGAATGGT
CAAGTTGGCGCTTTCAATAGCGAGTGGTCTGGCTCACCTACACATGGAGATCGTGGGCACTCAA
GGTAAGCCTGCTATTGCTCACCGAGATATAAAGTCAAAGAATATCTTAGTCAAAAAGTGTGACA
CTTGTGCCATAGCTGACTTAGGGCTGGCTGTGAAACATGATTCTATCATGAACACTATAGATAT
ACCCCAGAATCCTAAAGTGGGAACCAAGAGGTATATGGCTCCCGAAATGCTTGATGATACAATG
AACGTCAACATCTTTGAGTCCTTCAAGCGAGCTGACATCTATTCGGTGGGGCTGGTTTACTGGG
AAATAGCTCGAAGGTGTTCAGTTGGAGGACTTGTTGAAGAGTACCAGTTGCCTTATTATGACAT
GGTGCCTTCAGATCCTTCCATAGAGGAAATGAGGAAGGTCGTTTGTGATCAGAAACTCCGACCA
AATCTCCCAAACCAGTGGCAAAGCTGTGAGGCGCTCCGGGTCATGGGAAGAATAATGCGTGAGT
GCTGGTATGCCAACGGGGCAGCTCGCCTGACCGCCCTGCGCGTGAAGAAGACCATTTCTCAGCT
GTGTGTCAAGGAAGACTGTAAGGCCTAAGGCGCATACAGGCGACGGGAAAGCCCTCACCACTCT
CTTTCATGTCTCCTGCTTTGTGTAAATGTTTTCGTTTCTTTTCTGCTGTGTTTTGTTTTAGTTC
TACCTCAAAGATGATTCACTACAGTGTTGAAGTGTCCAAAGGCAGCATGAAAAGATAACTCTAA
GCATGGGCAGGTCTTGACTTTCCCAGTTTCCATGTTGTCCGTACTTTTATTTTTAAAGGTGACA
CTATTCATTTTTCTTTTTATTTAAGGAGGAAGATGTTAT

hide sequence

RefSeq Acc Id:

XM_039104246 ⟹ XP_038960174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	63,224,322 - 63,301,252 (-)	NCBI
mRatBN7.2	3	42,815,490 - 42,892,423 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_620790	(Get FASTA)	NCBI Sequence Viewer
	XP_038960174	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB04813	(Get FASTA)	NCBI Sequence Viewer
	AAC52803	(Get FASTA)	NCBI Sequence Viewer
	AAC52919	(Get FASTA)	NCBI Sequence Viewer
	EDM00404	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056047
	ENSRNOP00000056047.3
	ENSRNOP00000083168.1
	ENSRNOP00000088735.1
	ENSRNOP00000094234.1
GenBank Protein	P70539	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_620790 ⟸ NM_139090
- Peptide Label:	precursor
- UniProtKB:	P70603 (UniProtKB/Swiss-Prot), P70539 (UniProtKB/Swiss-Prot), F1LQM3 (UniProtKB/TrEMBL), A6JF56 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTPASRSALSLALLLVALASDLAAGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCV SLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPDAPRLGPTELTVVITVPVCLLSIA AMLTIWACQDRQCTYRKTKRHNVEEPLAEYSLVNAGKTLKDLIYDATASGSGSGLPLLVQRTIA RTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQTVMLRHENILGFIAAD NKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMVKLALSIASGLAHLHMEIVGTQGKPAIA HRDIKSKNILVKKCDTCAIADLGLAVKHDSIMNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFE SFKRADIYSVGLVYWEIARRCSVGGLVEEYQLPYYDMVPSDPSIEEMRKVVCDQKLRPNLPNQW QSCEALRVMGRIMRECWYANGAARLTALRVKKTISQLCVKEDCKA hide sequence

Ensembl Acc Id:

ENSRNOP00000056047 ⟸ ENSRNOT00000059280

RefSeq Acc Id:	XP_038960174 ⟸ XM_039104246
- Peptide Label:	isoform X1
- UniProtKB:	P70603 (UniProtKB/Swiss-Prot), P70539 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000094234 ⟸ ENSRNOT00000107627

Ensembl Acc Id:

ENSRNOP00000088735 ⟸ ENSRNOT00000099861

Ensembl Acc Id:

ENSRNOP00000083168 ⟸ ENSRNOT00000101769

Protein Domains

GS Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70539-F1-model_v2	AlphaFold	P70539	1-493	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621789	AgrOrtholog
BioCyc Gene	G2FUF-49658	BioCyc
Ensembl Genes	ENSRNOG00000004828	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000059280	ENTREZGENE
	ENSRNOT00000059280.5	UniProtKB/TrEMBL
	ENSRNOT00000099861.1	UniProtKB/TrEMBL
	ENSRNOT00000101769.1	UniProtKB/TrEMBL
	ENSRNOT00000107627.1	UniProtKB/TrEMBL
Gene3D-CATH	2.10.60.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Activin_recp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GS_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_kinase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser-Thr/Tyr_kinase_cat_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Snake_toxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGFB_receptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:245921	UniProtKB/Swiss-Prot
NCBI Gene	245921	ENTREZGENE
PANTHER	ACTIVIN RECEPTOR TYPE-1C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR23255	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Activin_recp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pkinase_Tyr	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGF_beta_GS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Acvr1c	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PS51256	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004828	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00467	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57302	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZUX4_RAT	UniProtKB/TrEMBL
	A0A8I6A748_RAT	UniProtKB/TrEMBL
	A0A8I6AKH6_RAT	UniProtKB/TrEMBL
	A6JF56	ENTREZGENE, UniProtKB/TrEMBL
	ACV1C_RAT	UniProtKB/Swiss-Prot
	F1LQM3	ENTREZGENE, UniProtKB/TrEMBL
	P70539	ENTREZGENE
	P70603	ENTREZGENE
UniProt Secondary	P70603	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Acvr1c	activin A receptor type 1C	Acvr1c	activin A receptor, type IC	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Acvr1c	activin A receptor, type IC		activin receptor-like kinase 7	Name updated	1299863	APPROVED
2004-09-10	Acvr1c	activin receptor-like kinase 7	Alk7		Symbol and Name updated	1299863	APPROVED
2002-08-07	Alk7	activin receptor-like kinase 7			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in neurons of various regions of the adult central nervous system	631880

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)