Grp (gastrin releasing peptide) - Rat Genome Database

Name: Grp
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Grp (gastrin releasing peptide) Rattus norvegicus

Analyze

Symbol:

Grp

Name:

gastrin releasing peptide

RGD ID:

621740

Description:

Predicted to enable neuropeptide hormone activity. Involved in several processes, including cellular response to sodium phosphate; neuropeptide signaling pathway; and positive regulation of vascular associated smooth muscle cell apoptotic process. Located in extracellular space. Is active in neuronal dense core vesicle. Biomarker of chronic kidney disease. Orthologous to human GRP (gastrin releasing peptide); INTERACTS WITH 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil; adenine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

gastrin-releasing peptide

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GRP (gastrin releasing peptide)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Grp (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Grp (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GRP (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GRP (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Grp (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GRP (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GRP (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Grp (gastrin releasing peptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RNF17 (ring finger protein 17)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Grp (gastrin releasing peptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GRP (gastrin releasing peptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	grp (gastrin-releasing peptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	grp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	61,658,655 - 61,672,037 (+)	NCBI		GRCr8
mRatBN7.2	18	59,388,679 - 59,402,061 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	59,388,274 - 59,402,061 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	61,481,572 - 61,495,017 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	62,180,256 - 62,193,696 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	60,008,373 - 60,021,747 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	61,563,458 - 61,576,818 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	61,563,053 - 61,576,818 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	60,759,485 - 60,772,845 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	62,162,526 - 62,176,328 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	62,236,136 - 62,249,529 (+)	NCBI
Celera	18	57,511,148 - 57,523,903 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amnestic disorder (ISO)

Aortic Calcification (ISO)

cerebrovascular disease (ISO)

chronic kidney disease (IEP)

colorectal cancer (ISO)

congestive heart failure (ISO)

Experimental Liver Neoplasms (ISO)

Head and Neck Neoplasms (ISO)

immunodeficiency 12 (ISO)

isolated microphthalmia 3 (ISO)

kidney failure (ISO)

lung non-small cell carcinoma (ISO)

lung small cell carcinoma (ISO)

pneumonia (ISO)

prostate cancer (ISO)

Pruritus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

3,7-dihydropurine-6-thione (EXP)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

adenine (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

copper(II) sulfate (ISO)

cypermethrin (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dibenz[a,h]anthracene (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

Goe 6976 (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

kuwanone G (ISO)

kuwanone H (EXP,ISO)

marimastat (ISO)

mercaptopurine (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

ozone (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphate(3-) (EXP)

progesterone (ISO)

propanal (ISO)

purine-6-thiol (EXP)

resveratrol (ISO)

Ro 31-8220 (ISO)

rottlerin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

staurosporine (ISO)

tetraphene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

troglitazone (EXP)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to sodium phosphate (IEP)

mast cell degranulation (ISO,ISS)

negative regulation of voltage-gated potassium channel activity (IDA)

negative regulation of voltage-gated sodium channel activity (IDA)

neuropeptide signaling pathway (IBA,IMP,ISO)

ossification (IMP)

positive regulation of behavioral fear response (ISO,ISS)

positive regulation of peptide hormone secretion (ISO,ISS)

positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway (ISO,ISS)

positive regulation of respiratory gaseous exchange (ISO,ISS)

positive regulation of vascular associated smooth muscle cell apoptotic process (IMP)

psychomotor behavior (ISO)

regulation of gene expression (IMP)

response to external biotic stimulus (ISO)

social behavior (ISO)

Cellular Component

extracellular region (IDA)

extracellular space (IBA,IDA,ISO,ISS)

neuron projection (ISO,ISS)

neuronal dense core vesicle (IDA)

secretory granule lumen (ISS)

Molecular Function

neuropeptide hormone activity (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Morphofunctional characteristics of the gastrin-releasing peptide-synthesizing system of the hypothalamus in normal conditions and in experimental diabetes in rats.	Abramov AV and Kolesnik YM, Neurosci Behav Physiol 2002 Nov-Dec;32(6):567-72.
2.	Clinical Application of Pro-Gastrin-Releasing Peptide.	Fang L, etal., Clin Lab. 2018 Jul 1;64(7):1259-1268. doi: 10.7754/Clin.Lab.2018.180316.
3.	Gastrin-releasing peptide microinjected into the amygdala inhibits feeding.	Fekete E, etal., Brain Res 2002 Nov 15;955(1-2):55-63.
4.	Gastrin-releasing peptide mediated regulation of 5-HT neuronal activity in the hypothalamic paraventricular nucleus under basal and restraint stress conditions.	Garrido MM, etal., Life Sci 2002 May 10;70(25):2953-66.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Regulatory peptides in the plasma of patients with chronic cardiac failure at rest and during exercise.	Nicholls DP, etal., Eur Heart J. 1992 Oct;13(10):1399-404. doi: 10.1093/oxfordjournals.eurheartj.a060073.
9.	Inhibition of Gastrin-Releasing Peptide Attenuates Phosphate-Induced Vascular Calcification.	Park HJ, etal., Cells. 2020 Mar 17;9(3):737. doi: 10.3390/cells9030737.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Pro-gastrin-releasing peptide and outcome in patients with heart failure and anaemia: results from the RED-HF study.	Ueland T, etal., ESC Heart Fail. 2018 Dec;5(6):1052-1059. doi: 10.1002/ehf2.12312. Epub 2018 Aug 25.
13.	Gamma-aminobutyrate, gastrin releasing peptide, serotonin, somatostatin, and vasopressin: ultrastructural immunocytochemical localization in presynaptic axons in the suprachiasmatic nucleus.	van den Pol AN, Neuroscience. 1986 Mar;17(3):643-59. doi: 10.1016/0306-4522(86)90037-0.
14.	The effects of gastrin-releasing peptide on the voltage-gated channels in rat hippocampal neurons.	Yang J, etal., Neuropeptides. 2020 Dec;84:102080. doi: 10.1016/j.npep.2020.102080. Epub 2020 Aug 12.

Additional References at PubMed

PMID:496973	PMID:2843761	PMID:3211139	PMID:8756537	PMID:8889548	PMID:15140764	PMID:17335915	PMID:18662341	PMID:18818295	PMID:19169356	PMID:19359382	PMID:19864484
PMID:20974156	PMID:21055429	PMID:22210008	PMID:23359674	PMID:24254931	PMID:24291388	PMID:24556509	PMID:24874706	PMID:24993846	PMID:26658875	PMID:26860455	PMID:28280205

Genomics

Comparative Map Data

Grp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	61,658,655 - 61,672,037 (+)	NCBI		GRCr8
mRatBN7.2	18	59,388,679 - 59,402,061 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	59,388,274 - 59,402,061 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	61,481,572 - 61,495,017 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	62,180,256 - 62,193,696 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	60,008,373 - 60,021,747 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	61,563,458 - 61,576,818 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	61,563,053 - 61,576,818 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	60,759,485 - 60,772,845 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	62,162,526 - 62,176,328 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	62,236,136 - 62,249,529 (+)	NCBI
Celera	18	57,511,148 - 57,523,903 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

GRP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	59,219,189 - 59,230,771 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	59,220,158 - 59,230,774 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	56,887,390 - 56,898,003 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	55,038,380 - 55,048,983 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	55,038,379 - 55,048,980	NCBI
Celera	18	53,605,282 - 53,615,885 (+)	NCBI		Celera
Cytogenetic Map	18	q21.32	NCBI
HuRef	18	53,595,537 - 53,606,136 (+)	NCBI		HuRef
CHM1_1	18	56,882,622 - 56,893,227 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	59,420,451 - 59,432,025 (+)	NCBI		T2T-CHM13v2.0

Grp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	66,005,826 - 66,019,670 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	66,005,891 - 66,019,667 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	65,872,751 - 65,886,599 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	65,872,820 - 65,886,596 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	66,033,148 - 66,046,233 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	65,998,863 - 66,011,948 (+)	NCBI		MGSCv36	mm8
Celera	18	67,148,374 - 67,161,630 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	38.98	NCBI

Grp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	43,382,552 - 43,393,463 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	43,382,608 - 43,393,452 (+)	NCBI	ChiLan1.0	ChiLan1.0

GRP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	76,763,081 - 76,776,923 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	62,455,695 - 62,469,561 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	52,614,169 - 52,626,427 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	55,941,405 - 55,953,188 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	55,942,263 - 55,953,188 (+)	Ensembl	panpan1.1		panPan2

GRP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	16,974,818 - 16,987,578 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	16,975,113 - 16,987,531 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	17,949,830 - 17,962,541 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	16,851,713 - 16,864,426 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	16,851,715 - 16,864,617 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	16,887,063 - 16,899,774 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	16,807,873 - 16,820,608 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	17,069,404 - 17,082,115 (-)	NCBI		UU_Cfam_GSD_1.0

Grp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	30,237,465 - 30,248,354 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936497	5,476,800 - 5,487,358 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936497	5,473,293 - 5,487,344 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GRP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	161,708,812 - 161,721,782 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	161,708,815 - 161,721,986 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	179,286,730 - 179,292,302 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GRP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	20,496,201 - 20,508,551 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	20,496,516 - 20,507,153 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666060	5,077,640 - 5,091,595 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Grp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624792	4,623,097 - 4,633,570 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624792	4,623,082 - 4,633,545 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Grp
240 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	280
Count of miRNA genes:	175
Interacting mature miRNAs:	204
Transcripts:	ENSRNOT00000022845
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	52292875	59796643	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	46718763	59796643	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	58805687	63636873	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	46988939	60377753	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59330409	70263868	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	59796643	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	3	1	90	18	15	4	4	4	3	42	7	87	20	49	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AW524119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF567195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M31176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022845 ⟹ ENSRNOP00000022845

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	59,388,274 - 59,402,061 (+)	Ensembl
Rnor_6.0 Ensembl	18	61,563,053 - 61,576,818 (+)	Ensembl

RefSeq Acc Id:

NM_133570 ⟹ NP_598254

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	61,658,655 - 61,672,037 (+)	NCBI
mRatBN7.2	18	59,388,679 - 59,402,061 (+)	NCBI
Rnor_6.0	18	61,563,458 - 61,576,818 (+)	NCBI
Rnor_5.0	18	60,759,485 - 60,772,845 (+)	NCBI
RGSC_v3.4	18	62,162,526 - 62,176,328 (+)	RGD
Celera	18	57,511,148 - 57,523,903 (+)	NCBI

Sequence:

show sequence

TCGAAGCGGCAGTGGCAGAGCTCCTGAGAACTGTCCTCCTGTCACTGCTCTGTCGGGACAACGC
ACTCTCAGCCTAGTGGAGCGCTCTGAGGGCTTCCCTCCAGGACCATGCGCGGCTCCGAGCTCTC
GCTCTTGCTGTTGGCTCTGGTCCTCTGCCAGGCTCCCCGGGGGCCAGCTGCCCCGGTGTCGACA
GGCGCAGGTGGAGGCACAGTCCTGGCCAAGATGTATCCGCGCGGCAGCCACTGGGCTGTAGGAC
ACTTAATGGGGAAGAAGAGCACAGATGAGTTGCCGCCCCTGTATGCAGCTGACAGAGATGGCCT
GAAGGAGCAACTGAGGGGATACATCCGCTGGGAAGAAGCTGCAAGGAATTTGCTTGGCCTCCTC
GAAGCCGCGGGGAACAGAAGCCACCAGCCACCTCAGGATCAGCCTCTGGGCAGTCTCCAGCCTA
CTTGGGATCCAGAGGATGGCAGCTACTTCAGTGATGCTCAAAATGCTAAGTTGGTAGACTCTCT
GCTCCAGGTTCTCAAGGGGAAGGAAGGAACTGCCAGCTGAAGGGACCATGACAAGGGCGGCTTC
CAAGGAGCAAAACAAAACCCCCCAGAGACTGCCTTCTGCAAACATTGATTCTACTGGACCATCA
ACAAGATTCCCTTTGTGCAATTTACGTAACTATTCTCATGTCACTCAACTGCAACTAAACTCGT
GATTTTTGAGCAGCATCTTCTGGTTTGAACCTGTTTCTGTGAACAACTACCTAGGAAGAGCTTT
CCAGTGAACGCTTTTTCCAGCTAGGCTTTTTTGCTGATTGGATTTGGGGCTCCAATCTGCTACC
ATTCACAATAAAAAGCTTCAGTAATCACACTGTCAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_598254	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41197	(Get FASTA)	NCBI Sequence Viewer
	EDM14697	(Get FASTA)	NCBI Sequence Viewer
	EDM14698	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022845.1
GenBank Protein	P24393	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598254 ⟸ NM_133570
- Peptide Label:	preproprotein
- UniProtKB:	G3V871 (UniProtKB/Swiss-Prot), P24393 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDELPPLY AADRDGLKEQLRGYIRWEEAARNLLGLLEAAGNRSHQPPQDQPLGSLQPTWDPEDGSYFSDAQN AKLVDSLLQVLKGKEGTAS hide sequence

Ensembl Acc Id:

ENSRNOP00000022845 ⟸ ENSRNOT00000022845

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P24393-F1-model_v2	AlphaFold	P24393	1-147	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621740	AgrOrtholog
BioCyc Gene	G2FUF-7200	BioCyc
Ensembl Genes	ENSRNOG00000016999	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022845.3	UniProtKB/Swiss-Prot
InterPro	Bombesin	UniProtKB/Swiss-Prot
KEGG Report	rno:171101	UniProtKB/Swiss-Prot
NCBI Gene	171101	ENTREZGENE
PANTHER	PTHR16866	UniProtKB/Swiss-Prot
	PTHR16866:SF2	UniProtKB/Swiss-Prot
Pfam	Bombesin	UniProtKB/Swiss-Prot
PhenoGen	Grp	PhenoGen
PROSITE	BOMBESIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016999	RatGTEx
UniProt	G3V871	ENTREZGENE
	GRP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	G3V871	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-12-14	Grp	gastrin releasing peptide		gastrin-releasing peptide	Name updated	1299863	APPROVED
2002-08-07	Grp	gastrin-releasing peptide			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD