Ccn3 (cellular communication network factor 3)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ccn3 (cellular communication network factor 3) Rattus norvegicus

Analyze

Symbol:

Ccn3

Name:

cellular communication network factor 3

RGD ID:

621553

Description:

Predicted to enable Notch binding activity; heparin binding activity; and integrin binding activity. Involved in chondrocyte differentiation and negative regulation of sensory perception of pain. Acts upstream of or within regulation of gene expression. Located in several cellular components, including dendrite; gap junction; and neuronal cell body. Orthologous to human CCN3 (cellular communication network factor 3); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CCN family member 3; nephroblastoma overexpressed; nephroblastoma overexpressed gene; nephroblastoma overexpressed gene protein homolog; nephroblastoma-overexpressed gene protein homolog; Nov; novH; protein NOV homolog

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	86,094,000 - 86,101,022 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	86,094,000 - 86,101,019 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	87,980,947 - 87,987,976 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	90,182,154 - 90,189,181 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	89,987,634 - 89,994,661 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	94,375,134 - 94,382,154 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	94,375,020 - 94,383,024 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	95,015,159 - 95,022,179 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	91,162,676 - 91,169,696 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	91,196,905 - 91,203,925 (+)	NCBI
Celera	7	82,897,053 - 82,904,052 (+)	NCBI		Celera
Cytogenetic Map	7	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

genetic disease (ISO)

hereditary multiple exostoses (ISO)

long QT syndrome (ISO)

pre-eclampsia (ISO)

stomach cancer (ISO)

trichorhinophalangeal syndrome type I (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-nitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

afimoxifene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bromochloroacetic acid (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chloroethene (ISO)

chlorpromazine (EXP)

cisplatin (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

corticosterone (EXP)

cycloheximide (ISO)

cyclosporin A (EXP,ISO)

D-mannitol (ISO)

dexamethasone (ISO)

diazepam (EXP)

diethylstilbestrol (EXP,ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

ethanol (ISO)

fipronil (EXP)

flavonoids (EXP)

fluoxetine (EXP)

fulvestrant (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

isoflavones (ISO)

levonorgestrel (ISO)

lucanthone (ISO)

methylisothiazolinone (ISO)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (ISO)

nitrofen (EXP)

panobinostat (ISO)

paracetamol (EXP)

pentanal (ISO)

potassium chromate (ISO)

progesterone (ISO)

propanal (ISO)

raloxifene (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Soman (EXP)

T-2 toxin (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone undecanoate (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO,ISS)

bone regeneration (ISO,ISS)

cell adhesion (IBA)

cell adhesion mediated by integrin (ISO,ISS)

cell chemotaxis (ISO,ISS)

chondrocyte differentiation (IMP,ISO,ISS)

endothelial cell chemotaxis (ISO,ISS)

endothelial cell-cell adhesion (ISO,ISS)

fibroblast migration (ISO,ISS)

hematopoietic stem cell homeostasis (ISO)

negative regulation of cell growth (ISO,ISS)

negative regulation of chondrocyte proliferation (ISO,ISS)

negative regulation of inflammatory response (ISO,ISS)

negative regulation of insulin secretion (ISO,ISS)

negative regulation of monocyte chemotaxis (ISO,ISS)

negative regulation of myotube differentiation (ISO,ISS)

negative regulation of non-canonical NF-kappaB signal transduction (ISO,ISS)

negative regulation of sensory perception of pain (IMP)

negative regulation of SMAD protein signal transduction (ISO,ISS)

positive regulation of Notch signaling pathway (ISO,ISS)

regulation of gene expression (IDA)

signal transduction (IBA)

smooth muscle cell migration (ISO,ISS)

smooth muscle cell proliferation (ISO,ISS)

type B pancreatic cell proliferation (ISO,ISS)

Cellular Component

axon (IDA)

collagen-containing extracellular matrix (IDA)

cytoplasm (IDA,ISO)

dendrite (IDA)

extracellular matrix (IBA)

extracellular region (IDA)

gap junction (IDA,ISO)

intracellular membrane-bounded organelle (IEA,ISO)

neuronal cell body (IDA)

Molecular Function

growth factor activity (TAS)

heparin binding (IBA)

integrin binding (IBA,ISO)

Notch binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	CCN3 (NOV) interacts with connexin43 in C6 glioma cells: possible mechanism of connexin-mediated growth suppression.	Fu CT, etal., J Biol Chem. 2004 Aug 27;279(35):36943-50. Epub 2004 Jun 21.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Decreased expression of the angiogenic regulators CYR61 (CCN1) and NOV (CCN3) in human placenta is associated with pre-eclampsia.	Gellhaus A, etal., Mol Hum Reprod. 2006 Jun;12(6):389-99. Epub 2006 May 4.
4.	Identification of a prognostic 5-Gene expression signature for gastric cancer.	Hou JY, etal., J Cancer Res Clin Oncol. 2017 Apr;143(4):619-629. doi: 10.1007/s00432-016-2324-z. Epub 2016 Dec 29.
5.	Novel effects of CCN3 that may direct the differentiation of chondrocytes.	Janune D, etal., FEBS Lett. 2011 Oct 3;585(19):3033-40. doi: 10.1016/j.febslet.2011.08.024. Epub 2011 Aug 23.
6.	Cooperative regulation of chondrocyte differentiation by CCN2 and CCN3 shown by a comprehensive analysis of the CCN family proteins in cartilage.	Kawaki H, etal., J Bone Miner Res. 2008 Nov;23(11):1751-64. doi: 10.1359/jbmr.080615.
7.	NOV/CCN3 attenuates inflammatory pain through regulation of matrix metalloproteinases-2 and -9.	Kular L, etal., J Neuroinflammation. 2012 Feb 21;9:36. doi: 10.1186/1742-2094-9-36.
8.	NOV/CCN3 promotes maturation of cerebellar granule neuron precursors.	Le Dreau G, etal., Mol Cell Neurosci. 2009 Mar 12.
9.	Nephroblastoma overexpressed gene (NOV) codes for a growth factor that induces protein tyrosine phosphorylation.	Liu C, etal., Gene 1999 Oct 1;238(2):471-8.
10.	Determination of a potential role of the CCN family of growth regulators in connexin43 transfected C6 glioma cells.	McLeod TL, etal., Cell Commun Adhes 2001;8(4-6):441-5.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12050162	PMID:12695522	PMID:15181016	PMID:15345329	PMID:15489334	PMID:15611078	PMID:17463287	PMID:20139355	PMID:20635690	PMID:21063504	PMID:21209863	PMID:22538190
PMID:23653360	PMID:23705021	PMID:24006456	PMID:24406215	PMID:24722330	PMID:27853940	PMID:30149912	PMID:31494663

Genomics

Comparative Map Data

Ccn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	86,094,000 - 86,101,022 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	86,094,000 - 86,101,019 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	87,980,947 - 87,987,976 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	90,182,154 - 90,189,181 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	89,987,634 - 89,994,661 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	94,375,134 - 94,382,154 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	94,375,020 - 94,383,024 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	95,015,159 - 95,022,179 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	91,162,676 - 91,169,696 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	91,196,905 - 91,203,925 (+)	NCBI
Celera	7	82,897,053 - 82,904,052 (+)	NCBI		Celera
Cytogenetic Map	7	q32	NCBI

CCN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	119,416,446 - 119,424,434 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	119,416,446 - 119,424,434 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	120,428,686 - 120,436,674 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	120,497,882 - 120,505,776 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	120,497,881 - 120,505,776	NCBI
Celera	8	116,617,968 - 116,626,094 (+)	NCBI		Celera
Cytogenetic Map	8	q24.12	NCBI
HuRef	8	115,749,069 - 115,757,195 (+)	NCBI		HuRef
CHM1_1	8	120,469,559 - 120,477,685 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	120,544,918 - 120,552,906 (+)	NCBI		T2T-CHM13v2.0

Ccn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	54,609,306 - 54,617,158 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	54,609,098 - 54,617,435 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	54,745,910 - 54,753,762 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	54,745,702 - 54,754,039 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	54,577,483 - 54,585,317 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	54,576,011 - 54,583,845 (+)	NCBI		MGSCv36	mm8
Celera	15	56,280,961 - 56,288,712 (+)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI
cM Map	15	21.49	NCBI

Ccn3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955417	25,218,613 - 25,225,755 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	8	112,353,155 - 112,361,507 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	116,105,935 - 116,114,241 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	118,856,969 - 118,865,039 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	118,855,445 - 118,865,039 (+)	Ensembl	panpan1.1		panPan2

CCN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	18,507,586 - 18,515,755 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	18,507,580 - 18,514,619 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	18,513,047 - 18,521,248 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	18,834,948 - 18,843,041 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	18,834,910 - 18,843,404 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	18,562,694 - 18,570,869 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	18,661,289 - 18,669,494 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	18,892,544 - 18,900,635 (+)	NCBI		UU_Cfam_GSD_1.0

Ccn3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	19,752,276 - 19,759,704 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	27,178,621 - 27,185,564 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936470	27,178,439 - 27,185,554 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	19,505,701 - 19,514,406 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	19,505,698 - 19,514,481 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	20,525,288 - 20,534,032 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	113,989,862 - 113,998,187 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	113,990,152 - 113,998,261 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	26,294,069 - 26,302,119 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	17,573,718 - 17,580,925 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624763	17,573,693 - 17,580,884 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ccn3
26 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	222
Count of miRNA genes:	155
Interacting mature miRNAs:	176
Transcripts:	ENSRNOT00000011904
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat

Markers in Region

RH139893

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	86,100,695 - 86,100,897 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	94,381,828 - 94,382,029	NCBI	Rnor6.0
Rnor_5.0	7	95,021,853 - 95,022,054	UniSTS	Rnor5.0
RGSC_v3.4	7	91,169,370 - 91,169,571	UniSTS	RGSC3.4
Celera	7	82,903,726 - 82,903,927	UniSTS
Cytogenetic Map	7	q31	UniSTS

Nov

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	86,094,278 - 86,094,400 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	94,375,413 - 94,375,534	NCBI	Rnor6.0
Rnor_5.0	7	95,015,438 - 95,015,559	UniSTS	Rnor5.0
RGSC_v3.4	7	91,162,955 - 91,163,076	UniSTS	RGSC3.4
Celera	7	82,897,311 - 82,897,432	UniSTS
Cytogenetic Map	7	q31	UniSTS

Nov

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	86,094,436 - 86,095,889 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	94,375,571 - 94,377,021	NCBI	Rnor6.0
Rnor_5.0	7	95,015,596 - 95,017,046	UniSTS	Rnor5.0
RGSC_v3.4	7	91,163,113 - 91,164,563	UniSTS	RGSC3.4
Celera	7	82,897,469 - 82,898,919	UniSTS
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	25	7		1		6	7	33	6	12	11	6
Low	1	16	38	29	18	29	2	4	33	29	29		2
Below cutoff		2	12	12		12			8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_030868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF171936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011904 ⟹ ENSRNOP00000011904

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	86,094,000 - 86,101,019 (+)	Ensembl
Rnor_6.0 Ensembl	7	94,375,020 - 94,383,024 (+)	Ensembl

RefSeq Acc Id:

NM_030868 ⟹ NP_110495

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	86,094,000 - 86,101,022 (+)	NCBI
Rnor_6.0	7	94,375,134 - 94,382,154 (+)	NCBI
Rnor_5.0	7	95,015,159 - 95,022,179 (+)	NCBI
RGSC_v3.4	7	91,162,676 - 91,169,696 (+)	RGD
Celera	7	82,897,053 - 82,904,052 (+)	RGD

Sequence:

show sequence

GTCCCGTCTCCAACTGGTAACAGCCCCAGCAGGCAGAACATGAGCGTCTTCCTGCGAAAGCAAT
GCCTCTGCCTAGGCTTCCTGCTCCTCCATCTCTTAAATCAAGTCTCTGCAACTCTGCGCTGCCC
GTCTCGGTGCCCGAGCCAGTGCCCCAGTATATCACCGACCTGCGCCCCCGGGGTGCGCTCGGTG
CTAGACGGCTGCTCCTGCTGTCCGGTGTGCGCCCGCCAGCGCGGGGAGAGTTGCTCTGAGATGA
GACCCTGCGACCAGAGCAGCGGTCTCTACTGCGACCGCAGCGCGGACCCCAACAACGAGACTGG
CATTTGCATGGTTCCAGAGGGAGACAACTGTGTGTTCGATGGGGTCATTTACCGCAATGGAGAG
AAGTTTGAGCCGAACTGTCAATACCACTGCACCTGCAGAGATGGGCAAATTGGCTGTGTGCCCC
GCTGCCAGCTGGATGTGCTTCTGCCAGGTCCTGACTGCCCAGCTCCAAAAAAAGTCGCAGTGCC
CGGGGAGTGTTGCGAAAAGTGGACCTGTGGCTCAGAGGAGAAGGGGACACTGGGAGGCCTGGCC
CTTCCAGCCTACAGACCGGAAGCTACCGTAGGAGTCGAACTCTCTGACTCCAGCATCAACTGCA
TTGAGCAGACTACAGAGTGGAGCGCGTGTTCCAAGAGCTGTGGAATGGGCTTGTCCACCCGGGT
CACCAACAGGAATCTCCAATGTGAGATGGTAAAACAGACTCGTCTCTGCATGGTTCGGCCTTGT
GAGCAAGAGCCTGGGGAAGCAACAGACATGAAAGGTAAAAAGTGTCTCCGGACCAAGAAGTCCC
TGAAATCCATCCACCTACAGTTCAAGAATTGCACTAGCCTGTACACCTATAAGCCCAGGTTCTG
TGGGATCTGCAGTGACGGGCGCTGCTGTACGCCCTTCAATACCAAAACCATCCAGGTGGAGTTT
CAGTGTTTGCCAGGGCAAATCATCAAAAAACCAGTCATGGTCATTGGAACCTGTACCTGCCACT
CCAACTGCCCTCAGAACAATGAGGCCTTCCTCCAAGAGCTGGAGCTGAAGACGAGCAGAGGAGA
AATGTAACAGGTGCCCAGGGAAGTGCATTCGTTGAGGCAAACTGTTGCTGTCACAAGGCCCGCC
ATCACCTGTATATAAGAAACATAGTGAAGGAGTTGTCCCGTGTATGTTTCTGTGATCATATGAG
GTCATTTATATTTGTCTCTGTTTTTAATGAAAACTGTTCCAAATGTAAACTTAGAATCAAGATA
AGCTCAGGATATGGCTTAGGGGTGACTTGCTTTCCTGTGCTGTTCATTACAAGTGCAAATTTGT
GTAAATTTAAGTCACATAGATGATCTAGTTGGTAGAATGTGTCACATCACACTCATTTTCTGTA
CATTAGTTAAATCCCAATAAATGTTACAGAAATGATTGGCACAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_110495	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD49371	(Get FASTA)	NCBI Sequence Viewer
	AAH72548	(Get FASTA)	NCBI Sequence Viewer
	EDM16261	(Get FASTA)	NCBI Sequence Viewer
	Q9QZQ5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_110495 ⟸ NM_030868
- Peptide Label:	precursor
- UniProtKB:	Q9QZQ5 (UniProtKB/Swiss-Prot), A6HRG0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSVFLRKQCLCLGFLLLHLLNQVSATLRCPSRCPSQCPSISPTCAPGVRSVLDGCSCCPVCARQ RGESCSEMRPCDQSSGLYCDRSADPNNETGICMVPEGDNCVFDGVIYRNGEKFEPNCQYHCTCR DGQIGCVPRCQLDVLLPGPDCPAPKKVAVPGECCEKWTCGSEEKGTLGGLALPAYRPEATVGVE LSDSSINCIEQTTEWSACSKSCGMGLSTRVTNRNLQCEMVKQTRLCMVRPCEQEPGEATDMKGK KCLRTKKSLKSIHLQFKNCTSLYTYKPRFCGICSDGRCCTPFNTKTIQVEFQCLPGQIIKKPVM VIGTCTCHSNCPQNNEAFLQELELKTSRGEM hide sequence

RefSeq Acc Id:

ENSRNOP00000011904 ⟸ ENSRNOT00000011904

Protein Domains

CTCK IGFBP N-terminal TSP type-1 VWFC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QZQ5-F1-model_v2	AlphaFold	Q9QZQ5	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621553	AgrOrtholog
BioCyc Gene	G2FUF-33391	BioCyc
Ensembl Genes	ENSRNOG00000008697	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000011904	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000011904	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.100.10	UniProtKB/Swiss-Prot
	Complement Module, domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thrombospondin type-1 (TSP1) repeat	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7105981	IMAGE-MGC_LOAD
InterPro	Cys_knot_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hormone_CN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Growth_fac_rcpt_cys_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGFBP-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGFBP_CNN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Insulin_GF-bd_Cys-rich_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TSP1_CCN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TSP1_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TSP1_rpt_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VWF_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81526	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91659	IMAGE-MGC_LOAD
NCBI Gene	81526	ENTREZGENE
PANTHER	CCN FAMILY MEMBER 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CONNECTIVE TISSUE GROWTH FACTOR-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Cys_knot	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGFBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TSP1_CCN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VWC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ccn3	PhenoGen
PIRSF	IGFBP_rP_CNN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CTCK_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTCK_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGFBP_N_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGFBP_N_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TSP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VWFC_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VWFC_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00041	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00121	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TSP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VWC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	FnI-like domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Growth factor receptor domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	SSF82895	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HRG0	ENTREZGENE, UniProtKB/TrEMBL
	CCN3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-11-02	Ccn3	cellular communication network factor 3	Nov	nephroblastoma overexpressed	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-05	Nov	nephroblastoma overexpressed	Nov	nephroblastoma overexpressed gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Nov	nephroblastoma overexpressed gene		NOV protein	Name updated	1299863	APPROVED
2002-08-07	Nov	NOV protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	colocalizes with Cx43 plaques at the cell membrane	633367

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar