Pllp (plasmolipin) - Rat Genome Database

Name: Pllp
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pllp (plasmolipin) Rattus norvegicus

Analyze

Symbol:

Pllp

Name:

plasmolipin

RGD ID:

621478

Description:

Predicted to be a structural constituent of myelin sheath. Involved in monoatomic ion transport and myelination. Located in compact myelin. Orthologous to human PLLP (plasmolipin); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

plasma membrane proteolipid; plasma membrane proteolipid (plasmolipin); Tm4sf11; transmembrane 4 superfamily member 11; Z49858

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLLP (plasmolipin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pllp (plasma membrane proteolipid)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pllp (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLLP (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLLP (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pllp (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLLP (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLLP (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pllp (plasmolipin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PLLP (plasmolipin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pllp (plasma membrane proteolipid)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pllp (plasmolipin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F47B3.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|PANTHER)
Drosophila melanogaster (fruit fly):	CG12730	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pllp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	10,315,104 - 10,335,892 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,315,104 - 10,335,892 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,278,287 - 10,299,166 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	11,045,134 - 11,066,015 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,332,082 - 10,352,963 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,731,855 - 10,752,641 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,731,855 - 10,752,641 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,725,892 - 10,746,753 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,754,737 - 10,776,134 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,759,562 - 10,780,960 (+)	NCBI
Celera	19	10,204,761 - 10,225,276 (+)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bardet-Biedl syndrome (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

genetic disease (ISO)

malignant mesothelioma (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

clofibrate (ISO)

clothianidin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cytarabine (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (EXP)

elemental selenium (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenthion (ISO)

fenvalerate (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

GW 4064 (ISO)

hydroquinone (ISO)

manganese(II) chloride (EXP)

methidathion (ISO)

morphine (ISO)

nickel atom (ISO)

nicotine (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (EXP,ISO)

progesterone (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

monoatomic ion transport (IDA)

myelination (IBA,IEP)

Cellular Component

compact myelin (IDA)

membrane (IEA)

Molecular Function

protein binding (ISO)

structural constituent of myelin sheath (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteolipid plasmolipin: localization in polarized cells, regulated expression and lipid raft association in CNS and PNS myelin.	Bosse F, etal., J Neurochem 2003 Jul;86(2):508-18.
2.	Molecular cloning of plasmolipin. Characterization of a novel proteolipid restricted to brain and kidney.	Fischer I and Sapirstein VS, J Biol Chem 1994 Oct 7;269(40):24912-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Full-lenth cloning, expression and cellular localization of rat plasmolipin mRNA, a proteolipid of PNS and CNS.	Gillen C, etal., Eur J Neurosci 1996 Feb;8(2):405-14.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:22871113	PMID:23376485

Genomics

Comparative Map Data

Pllp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	10,315,104 - 10,335,892 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,315,104 - 10,335,892 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,278,287 - 10,299,166 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	11,045,134 - 11,066,015 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,332,082 - 10,352,963 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,731,855 - 10,752,641 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,731,855 - 10,752,641 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,725,892 - 10,746,753 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,754,737 - 10,776,134 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,759,562 - 10,780,960 (+)	NCBI
Celera	19	10,204,761 - 10,225,276 (+)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

PLLP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	57,256,097 - 57,284,672 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	57,248,547 - 57,284,672 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	57,290,009 - 57,318,584 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	55,847,511 - 55,876,071 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	55,847,509 - 55,876,072	NCBI
Celera	16	41,789,697 - 41,818,338 (-)	NCBI		Celera
Cytogenetic Map	16	q13	NCBI
HuRef	16	43,159,649 - 43,188,192 (-)	NCBI		HuRef
CHM1_1	16	58,698,255 - 58,726,816 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	63,052,086 - 63,080,643 (-)	NCBI		T2T-CHM13v2.0

Pllp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	95,401,523 - 95,422,870 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	95,401,522 - 95,422,906 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	94,674,895 - 94,696,242 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	94,674,894 - 94,696,278 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	97,198,795 - 97,220,142 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	97,564,024 - 97,585,371 (-)	NCBI		MGSCv36	mm8
Celera	8	99,003,368 - 99,024,674 (-)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	46.66	NCBI

Pllp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	14,896,087 - 14,915,794 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	14,896,087 - 14,915,794 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLLP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	72,646,074 - 72,674,763 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	37,531,102 - 37,559,762 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	56,663,878 - 56,692,784 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	56,663,791 - 56,692,784 (-)	Ensembl	panpan1.1		panPan2

PLLP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	59,102,689 - 59,125,165 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	59,102,770 - 59,124,614 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	55,731,975 - 55,753,382 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	59,641,500 - 59,663,504 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	59,641,517 - 59,717,246 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	56,473,412 - 56,495,146 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	57,480,400 - 57,502,199 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	58,374,374 - 58,396,245 (+)	NCBI		UU_Cfam_GSD_1.0

Pllp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	50,214,238 - 50,235,529 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	9,353,542 - 9,375,042 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936475	9,353,546 - 9,374,826 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLLP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	19,211,761 - 19,241,228 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	19,214,037 - 19,241,251 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	17,207,773 - 17,232,191 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLLP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	43,204,815 - 43,232,558 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	43,204,612 - 43,232,380 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	33,087,690 - 33,114,787 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pllp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	28,779,173 - 28,797,638 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	28,779,154 - 28,797,828 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pllp
126 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	228
Count of miRNA genes:	160
Interacting mature miRNAs:	180
Transcripts:	ENSRNOT00000022277
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10323180	23069265	Rat

Markers in Region

D19Mgh4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,323,102 - 10,323,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,739,852 - 10,739,929	NCBI	Rnor6.0
Rnor_5.0	19	10,733,889 - 10,733,966	UniSTS	Rnor5.0
RGSC_v3.4	19	10,762,733 - 10,762,811	RGD	RGSC3.4
RGSC_v3.4	19	10,762,734 - 10,762,811	UniSTS	RGSC3.4
RGSC_v3.1	19	10,767,559 - 10,767,637	RGD
Celera	19	10,212,702 - 10,212,779	UniSTS
RH 3.4 Map	19	102.5	UniSTS
RH 3.4 Map	19	102.5	RGD
Cytogenetic Map	19	p12	UniSTS

RH127623

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,335,457 - 10,335,673 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,752,207 - 10,752,422	NCBI	Rnor6.0
Rnor_5.0	19	10,746,319 - 10,746,534	UniSTS	Rnor5.0
RGSC_v3.4	19	10,775,700 - 10,775,915	UniSTS	RGSC3.4
Celera	19	10,224,842 - 10,225,057	UniSTS
RH 3.4 Map	19	103.7	UniSTS
Cytogenetic Map	19	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		3	1		1				29	29	6
Low	3	30	19	4	18	4	8	11	43	6	35	11	8
Below cutoff		10	30	30		30			2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U13617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z49858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000022277 ⟹ ENSRNOP00000022277

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,315,104 - 10,335,892 (+)	Ensembl
Rnor_6.0 Ensembl	19	10,731,855 - 10,752,641 (+)	Ensembl

RefSeq Acc Id:

NM_022533 ⟹ NP_071978

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	10,315,104 - 10,335,892 (+)	NCBI
Rnor_6.0	19	10,731,855 - 10,752,641 (+)	NCBI
Rnor_5.0	19	10,725,892 - 10,746,753 (+)	NCBI
RGSC_v3.4	19	10,754,737 - 10,776,134 (+)	RGD
Celera	19	10,204,761 - 10,225,276 (+)	RGD

Sequence:

show sequence

TGCCCAAACACCAGCACACTAGGGGTTCTTCACGATCTCTATCCAGAGCAAACAGGCGAACCGA
GGGTTAAGGGGCGGGGCCTCTTCGAGGGGCGGGGCCTCGGGCGGAGCGGGGTCGGGCTTCGCGC
ACCTGTAGGTTCTGTCTAGGGATCCGCTGTCGCAGCCCCGGAGCAGCGCCGGGAGCGCGTCCCG
AGCGTCGTAGGCTCGCGATCGCTATGGCGGAGTTCCCGTCGAAAGTGAGCACCAGGACCAGCAG
CCCCGCGCAGGGCGTGGGAGCATCTGTGTCTGCGATGCGACCGGACCTGGGCTTTGTGCGCTCC
GCCCTTGGGGTGCTCGCGCTTCTGCAGCTGGTGCTGGGGCTGCTGGTGTGGGCCTTGATTGCTG
ACACCCCATACCACCTGTATCCTGCCTACGGCTGGGTTATGTTTGTAGCTGTCTTCCTCTGGCT
GGTAACAATTGTCTTCTTCATCATCTACCTGTTTCAACTGCACATGAAGTTGTATATGGTGCCC
TGGCCGTTGGTGTTACTGGTCTTCTTTGTTGCTGCCACCGTCCTCTATATCACCGCCTTTGTCG
CCTGTGCGGCGGCGGTCGATCTGACATCCCTGAGGGGCTCCCGACCGTACAACCAGCGCTCGGC
TGCCTCTTTCTTTGCTTGTCTGGTGATGATTGCCTACGGACTGAGTGCTTTCTTCAGCTTCCAG
GCCTGGCGAGGAGTGGGCAGCAACGCGGCCACGAGTCAGATGGCTGGGGGCTACTCTTAAGCCA
GCTATGCTGTGACCTAAGCCACGGCTGGGTCTTAGCACAGGGCCACCCCCAACCTTACCAGGCT
TAAGCTCTCCAAGCACTCCTGAGGAACAGGCCCAAGCTGGCACAGATGGACAGCCAAGAGCCAG
GAGCGGGGACATCCTCCTCACCTCCCTTATTCAGCAGAAGATGATGGGGTTGGGGGGCTCTTGT
GGCTTTGCCTTGTCATCAGAGAACTTCAGTGTCCCAGGCTGGGCCACCCTGCTCACCAGCACTA
AATGCACTAACAGACCTTCAGCCTCTGATCTGCCTAGTGTAAACCTAACAAGACAACACATGAT
CTACGTTCCAGAAGCTAAGCCCACCCCCAGGCTCTTCTGGACCCACCTCCCCCTCCCCTACCGC
ACGCCAACCCATTGTCACCTGTAGAGAGACTTTTATAGAAGAGTTGGGATTTCGAGGACTGGAC
TATTTCAGTTGGTTTCAATAGTTTCCAAGACAGCAAGCCTCACCATGTCCCCTCCCTCACGTGG
AACTCTTTCTCTCCTTTGGGAGAGAGCATCCGTGCAGGGTGCTCCCCCCAGGCTGCTGATTAGA
CACAGGGGACTTCCAAGGAGGGAGAGAGGGAAGCAGGGCCTTGCCTGGTGAGTTGTCAGGAGGT
TAATGGCGACTCTTATTTGGAATTATTATTTTTTACAATTTAAATAAAAATGGATGTGTCTGTT
TGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_071978	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA62133	(Get FASTA)	NCBI Sequence Viewer
	AAH78823	(Get FASTA)	NCBI Sequence Viewer
	CAA90017	(Get FASTA)	NCBI Sequence Viewer
	EDL87329	(Get FASTA)	NCBI Sequence Viewer
	P47987	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071978 ⟸ NM_022533
- UniProtKB:	P47987 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAEFPSKVSTRTSSPAQGVGASVSAMRPDLGFVRSALGVLALLQLVLGLLVWALIADTPYHLYP AYGWVMFVAVFLWLVTIVFFIIYLFQLHMKLYMVPWPLVLLVFFVAATVLYITAFVACAAAVDL TSLRGSRPYNQRSAASFFACLVMIAYGLSAFFSFQAWRGVGSNAATSQMAGGYS hide sequence

RefSeq Acc Id:

ENSRNOP00000022277 ⟸ ENSRNOT00000022277

Protein Domains

MARVEL

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P47987-F1-model_v2	AlphaFold	P47987	1-182	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621478	AgrOrtholog
BioCyc Gene	G2FUF-6504	BioCyc
Ensembl Genes	ENSRNOG00000016558	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000022277	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022277	ENTREZGENE, UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7108239	IMAGE-MGC_LOAD
InterPro	MAL	UniProtKB/Swiss-Prot
	Marvel	UniProtKB/Swiss-Prot
KEGG Report	rno:64364	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93437	IMAGE-MGC_LOAD
NCBI Gene	64364	ENTREZGENE
PANTHER	MARVEL-CONTAINING POTENTIAL LIPID RAFT-ASSOCIATED PROTEIN	UniProtKB/Swiss-Prot
	PLASMOLIPIN	UniProtKB/Swiss-Prot
Pfam	MARVEL	UniProtKB/Swiss-Prot
PhenoGen	Pllp	PhenoGen
PRINTS	MALPROTEIN	UniProtKB/Swiss-Prot
PROSITE	MARVEL	UniProtKB/Swiss-Prot
UniProt	A6JY51_RAT	UniProtKB/TrEMBL
	P47987	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Pllp	plasmolipin	Pllp	plasma membrane proteolipid (plasmolipin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Pllp	plasma membrane proteolipid (plasmolipin)	Pllp	plasma membrane proteolipid	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Pllp	plasma membrane proteolipid	Tm4sf11	transmembrane 4 superfamily member 11	Symbol and Name updated	1299863	APPROVED
2004-12-14	Tm4sf11	transmembrane 4 superfamily member 11	Z49858	plasmolipin	Symbol and Name updated	1299863	APPROVED
2002-08-07	Z49858	plasmolipin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	differentially expressed during sciatic nerve development and regeneration	634524
gene_expression	mRNA is expressed in sciatic nerve Schwann cells and in glial cells of myelinated brain structures	634524
gene_expression	expression is restricted to kidney and brain	634525

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD