Commd5 (COMM domain containing 5)

Advanced Search (OLGA)

Gene: Commd5 (COMM domain containing 5) Rattus norvegicus

Analyze

Symbol:

Commd5

Name:

COMM domain containing 5

RGD ID:

621468

Description:

Involved in positive regulation of cell growth; positive regulation of epithelial cell differentiation; and proximal tubule morphogenesis. Located in nucleus. Orthologous to human COMMD5 (COMM domain containing 5); INTERACTS WITH ammonium chloride; bisphenol A; buspirone.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

COMM domain-containing protein 5; HCaRG; hypertension-related calcium regulated; hypertension-related calcium-regulated gene protein; hypertension-related, calcium regulated; hypertension-related, calcium regulated gene; LOC108348189

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COMMD5 (COMM domain containing 5)	HGNC	Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Commd5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Commd5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COMMD5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COMMD5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Commd5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COMMD5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COMMD5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Commd5 (COMM domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LRRC10B (leucine rich repeat containing 10B)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Commd5 (COMM domain containing 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	COMMD5 (COMM domain containing 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	commd5 (COMM domain containing 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	LSm-4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	commd5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	110,502,492 - 110,503,916 (+)	NCBI		GRCr8
mRatBN7.2	7	108,621,766 - 108,623,616 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	108,598,673 - 108,624,764 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	110,364,881 - 110,366,305 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	112,588,466 - 112,589,890 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	112,549,895 - 112,551,319 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	117,963,213 - 117,965,010 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	118,502,676 - 118,504,097 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	7	117,963,740 - 117,964,414 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	118,495,267 - 118,497,078 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	114,949,725 - 114,951,149 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	114,983,954 - 114,985,374 (+)	NCBI
Celera	7	104,970,718 - 104,972,142 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

clofibrate (ISO)

copper(II) chloride (ISO)

doxorubicin (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

ketamine (EXP)

methapyrilene (EXP)

N(4)-hydroxycytidine (ISO)

nefazodone (EXP)

nickel dichloride (EXP)

nimesulide (EXP)

ochratoxin A (EXP)

paracetamol (ISO)

pirinixic acid (ISO)

rotenone (EXP)

sulindac (EXP)

thioacetamide (EXP)

thiram (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of cell growth (IDA)

positive regulation of epithelial cell differentiation (IDA)

proximal tubule morphogenesis (IDA)

Cellular Component

cytosol (ISO)

nucleoplasm (ISO)

nucleus (IBA,IDA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	HCaRG is a novel regulator of renal epithelial cell growth and differentiation causing G2M arrest.	Devlin AM, etal., Am J Physiol Renal Physiol 2003 Apr;284(4):F753-62.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Hypertension-related, calcium-regulated gene (HCaRG/COMMD5) and kidney diseases: HCaRG accelerates tubular repair.	Matsuda H, etal., J Nephrol. 2014 Aug;27(4):351-60. doi: 10.1007/s40620-014-0054-3. Epub 2014 Feb 11.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Chromosomal mapping of HCaRG, a novel hypertension-related, calcium-regulated gene.	Solban N, etal., Folia Biol (Praha) 2002;48(1):9-14.
9.	HCaRG, a novel calcium-regulated gene coding for a nuclear protein, is potentially involved in the regulation of cell proliferation.	Solban N, etal., J Biol Chem 2000 Oct 13;275(41):32234-43.

Additional References at PubMed

PMID:16033922	PMID:18949406

Genomics

Comparative Map Data

Commd5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	110,502,492 - 110,503,916 (+)	NCBI		GRCr8
mRatBN7.2	7	108,621,766 - 108,623,616 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	108,598,673 - 108,624,764 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	110,364,881 - 110,366,305 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	112,588,466 - 112,589,890 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	112,549,895 - 112,551,319 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	117,963,213 - 117,965,010 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	118,502,676 - 118,504,097 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	7	117,963,740 - 117,964,414 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	118,495,267 - 118,497,078 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	114,949,725 - 114,951,149 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	114,983,954 - 114,985,374 (+)	NCBI
Celera	7	104,970,718 - 104,972,142 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

COMMD5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	144,837,978 - 144,853,556 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	144,841,042 - 144,853,736 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	146,075,561 - 146,078,941 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	146,046,355 - 146,049,736 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	146,034,168 - 146,049,203	NCBI
Celera	8	142,252,099 - 142,255,480 (-)	NCBI		Celera
Cytogenetic Map	8	q24.3	NCBI
HuRef	8	141,191,401 - 141,194,782 (-)	NCBI		HuRef
CHM1_1	8	146,113,837 - 146,117,218 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	146,011,722 - 146,054,961 (-)	NCBI		T2T-CHM13v2.0

Commd5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	76,784,141 - 76,786,223 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	76,784,110 - 76,785,505 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	76,899,941 - 76,901,297 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	76,899,910 - 76,901,305 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	76,730,371 - 76,731,727 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	76,727,196 - 76,728,552 (+)	NCBI		MGSCv36	mm8
Celera	15	78,394,972 - 78,396,328 (+)	NCBI		Celera
Cytogenetic Map	15	D3	NCBI
cM Map	15	36.28	NCBI

Commd5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	3,322,253 - 3,324,313 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955454	3,322,253 - 3,324,313 (-)	NCBI	ChiLan1.0	ChiLan1.0

COMMD5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	162,349,677 - 162,350,841 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	137,881,305 - 137,889,248 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	141,623,725 - 141,627,532 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	144,604,228 - 144,607,656 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	144,604,718 - 144,605,392 (-)	Ensembl	panpan1.1		panPan2

COMMD5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	38,059,170 - 38,060,923 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	38,060,093 - 38,060,767 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	38,019,322 - 38,021,284 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	38,532,633 - 38,534,595 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	38,533,549 - 38,534,223 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	38,224,204 - 38,226,166 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	38,333,055 - 38,335,015 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	38,809,445 - 38,811,407 (+)	NCBI		UU_Cfam_GSD_1.0

Commd5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	165,788 - 167,805 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	7,591,783 - 7,594,509 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	7,591,783 - 7,593,904 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COMMD5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	178,093 - 181,190 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	178,527 - 180,842 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	8,465 - 10,782 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

COMMD5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	139,053,761 - 139,057,069 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	139,054,225 - 139,054,899 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	783,946 - 787,442 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Commd5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	12,153,120 - 12,155,452 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	12,154,180 - 12,155,452 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Commd5
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	299
Count of miRNA genes:	177
Interacting mature miRNAs:	197
Transcripts:	ENSRNOT00000005925, ENSRNOT00000075405
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

RH132088

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	108,623,010 - 108,623,230 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	118,503,818 - 118,504,037	NCBI	Rnor6.0
Rnor_6.0	7	117,964,412 - 117,964,631	NCBI	Rnor6.0
Rnor_5.0	7	117,949,075 - 117,949,294	UniSTS	Rnor5.0
Rnor_5.0	7	118,496,480 - 118,496,699	UniSTS	Rnor5.0
RGSC_v3.4	7	114,950,865 - 114,951,084	UniSTS	RGSC3.4
Celera	7	104,971,858 - 104,972,077	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
3	11	43	82	57	60	41	19	41	160	73	74	35	41	19

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_139108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF290194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005925 ⟹ ENSRNOP00000005925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	108,598,673 - 108,624,764 (+)	Ensembl
Rnor_6.0 Ensembl	7	118,502,676 - 118,504,097 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075405 ⟹ ENSRNOP00000065036

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	117,963,740 - 117,964,414 (+)	Ensembl

RefSeq Acc Id:

NM_139108 ⟹ NP_620808

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	110,502,492 - 110,503,916 (+)	NCBI
mRatBN7.2	7	108,621,871 - 108,623,295 (+)	NCBI
Rnor_6.0	7	117,963,272 - 117,964,696 (+)	NCBI
Rnor_5.0	7	118,495,267 - 118,497,078 (+)	NCBI
RGSC_v3.4	7	114,949,725 - 114,951,149 (+)	RGD
Celera	7	104,970,718 - 104,972,142 (+)	RGD

Sequence:

show sequence

AGCCACAGCCAGCTACCGCGGCTAGGTTCCTCCAGGTGCAGAGGGCGGTAAAGGCTTGGTTTGT
ATTTGTAATGCAACTGTGGTTAGGACCTTCTCTTCGGACTGGTCAAGAAACGGGAAGAAAGGAT
GTCTGCTTTGGGGGCTGCAGCTCCATACTTGCACCATCCCGCTGACAGTCACAGTGGCCGGGTC
AGTTTCCTGGGTTCCCAGCCCTCTCCAGAAGTGACGGCCGTGGCTCAGCTCTTGAAGGACTTAG
ACAGGAGCACCTTCAGAAAGTTGTTGAAACTTGTAGTCGGGGCCCTGCATGGGAAAGACTGCAG
AGAAGCTGTGGAGCAACTTGGTGCCAGCGCCAACCTGTCAGAAGAGCGTCTGGCCGTCCTGCTG
GCGGGCACACACACCCTGCTCCAGCAGGCTCTCCGGCTGCCCCCTGCTAGTCTAAAGCCAGATG
CCTTCCAGGAAGAGCTCCAGGAACTTGGCATTCCTCAGGATCTAATTGGAGATTTGGCCAGTTT
GGCATTTGGGAGTCAACGCCCTCTTCTCGACTCTGTAGCCCAACAGCAGGGATCCTCGCTGCCT
CACGTGTCTTACTTCCGGTGGCGGGTGGACGTGGCCATCTCAACCAGCGCTCAGTCCCGCTCCC
TGCAACCGAGTGTTCTCATGCAGCTGAAGCTCACAGATGGATCTGCACACCGCTTCGAGGTGCC
CATAGCCAAATTTCAGGAGCTGCGGTACAGTGTAGCCTTGGTCCTTAAGGAGATGGCAGAACTG
GAGAAGAAGTGTGAGCGCAAACTGCAGGACTGACTGAACCCTGGTACTGTGGGTGCTGAAGCTG
GTACCAGAACACAGCCCCCCACTGGTGATGAGCCCAACTCCATTGAGGTCCTGCATGTGAGAAC
GTATTTTAAGTGAAAAGACAGCGGGACTTTCAGGTTTTGTTTTATGAGTCAACAGCTGGGCAGG
GTGGCACAGTTTATAATCTCAGCCCTTGGAAGTCTGAGGCTGGAGAATGGGAAGTGTAAGCTGG
GCCTGGCTTTCATAGTGAGGCTCAGTGTCGAATTAAAGAGGTAAAGCAACTATTAAAAAAAAAA
AAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_620808	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG09914	(Get FASTA)	NCBI Sequence Viewer
	EDM15931	(Get FASTA)	NCBI Sequence Viewer
	EDM15932	(Get FASTA)	NCBI Sequence Viewer
	EDM15933	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005925.2
GenBank Protein	Q9ERR2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620808 ⟸ NM_139108

- UniProtKB:

Q9ERR2 (UniProtKB/Swiss-Prot), A6HSE1 (UniProtKB/TrEMBL), G3V6K0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDC
REAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLAS
LAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEV
PIAKFQELRYSVALVLKEMAELEKKCERKLQD

hide sequence

Ensembl Acc Id:

ENSRNOP00000065036 ⟸ ENSRNOT00000075405

Ensembl Acc Id:

ENSRNOP00000005925 ⟸ ENSRNOT00000005925

Protein Domains

COMM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ERR2-F1-model_v2	AlphaFold	Q9ERR2	1-224	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621468	AgrOrtholog
BioCyc Gene	G2FUF-32898	BioCyc
Ensembl Genes	ENSRNOG00000004484	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000050582	Ensembl
Ensembl Transcript	ENSRNOT00000005925.4	UniProtKB/TrEMBL
InterPro	COMM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	COMMD5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:245974	UniProtKB/Swiss-Prot
NCBI Gene	245974	ENTREZGENE
PANTHER	COMM DOMAIN-CONTAINING PROTEIN 5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR15666	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	COMM_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	COMM_HN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Commd5	PhenoGen
PROSITE	COMM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004484	RatGTEx
	ENSRNOG00000050582	RatGTEx
UniProt	A6HSE1	ENTREZGENE, UniProtKB/TrEMBL
	COMD5_RAT	UniProtKB/Swiss-Prot
	G3V6K0	ENTREZGENE, UniProtKB/TrEMBL
	Q9ERR2	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Commd5	COMM domain containing 5	LOC108348189	COMM domain-containing protein 5	Data merged from RGD:11356734	737654	PROVISIONAL
2016-08-02	LOC108348189	COMM domain-containing protein 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Commd5	COMM domain containing 5	Hcarg	hypertension-related, calcium regulated gene	Symbol and Name updated	1299863	APPROVED
2002-08-07	Hcarg	hypertension-related, calcium regulated gene			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a putative calcium-binding motif (EF-Hand) and a nuclear receptor-binding domain (LxxLL)	632846

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message