Ngb (neuroglobin) - Rat Genome Database

Name: Ngb
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ngb (neuroglobin) Rattus norvegicus

Analyze

Symbol:

Ngb

Name:

neuroglobin

RGD ID:

621461

Description:

Predicted to enable oxygen carrier activity. Involved in several processes, including cellular response to hydrogen peroxide; response to hypoxia; and response to iron ion. Located in perikaryon. Used to study transient cerebral ischemia. Biomarker of Alzheimer's disease; encephalitis; retinal ischemia; and transient cerebral ischemia. Orthologous to human NGB (neuroglobin); INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; barium sulfate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Glnh; globin h

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NGB (neuroglobin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Ngb (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ngb (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NGB (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NGB (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ngb (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NGB (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NGB (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ngb (neuroglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PDE2A (phosphodiesterase 2A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NGB (neuroglobin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ngb (neuroglobin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ngb (neuroglobin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ngb	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	106,744,378 - 106,749,830 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	106,744,378 - 106,749,830 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	106,912,130 - 106,917,574 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	107,210,967 - 107,216,411 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	106,580,643 - 106,586,085 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	111,126,259 - 111,131,699 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	111,126,261 - 111,132,320 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	120,412,241 - 120,417,508 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	111,231,188 - 111,236,255 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	111,234,718 - 111,239,786 (-)	NCBI
Celera	6	104,565,839 - 104,571,131 (-)	NCBI		Celera
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (IEP)

Brain Injuries (IEP)

encephalitis (IEP)

genetic disease (ISO)

Nervous System Heredodegenerative Disorders (ISO)

retinal ischemia (IEP)

Sleep Deprivation (IEP)

Subarachnoid Hemorrhage (IEP)

transient cerebral ischemia (IEP,IMP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

ammonium chloride (EXP)

andrographolide (ISO)

barium sulfate (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

calcium atom (ISO)

calcium(0) (ISO)

carbon dioxide (ISO)

carbon nanotube (ISO)

ceric oxide (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

cypermethrin (ISO)

dichlorine (ISO)

diuron (EXP)

fenvalerate (EXP)

ferroheme b (ISO)

folic acid (ISO)

glyphosate (EXP)

heme b (ISO)

iron atom (ISO)

iron(0) (ISO)

lead diacetate (EXP)

lead(0) (EXP,ISO)

lutein (ISO)

MC1568 (ISO)

N-methyl-4-phenylpyridinium (ISO)

nicotine (ISO)

ozone (ISO)

paraquat (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

polysulfur (ISO)

potassium atom (ISO)

reactive oxygen species (ISO)

rotenone (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP)

sulfur atom (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hydrogen peroxide (IMP)

negative regulation of apoptotic process (IMP)

neuron projection development (IMP)

oxygen transport (IBA,IEA,ISO)

positive regulation of catalytic activity (IMP)

response to hypoxia (IBA,IEP)

response to iron ion (IEP)

Cellular Component

perikaryon (IDA)

Molecular Function

heme binding (IEA)

metal ion binding (IEA)

oxygen binding (IBA,IEA)

oxygen carrier activity (IBA,IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Does neuroglobin protect neurons from ischemic insult? A quantitative investigation of neuroglobin expression following transient MCAo in spontaneously hypertensive rats.	Hundahl C, etal., Brain Res. 2006 Apr 26;1085(1):19-27. Epub 2006 May 2.
3.	Neuroglobin in the rat brain (II): co-localisation with neurotransmitters.	Hundahl CA, etal., Neuroendocrinology. 2008;88(3):183-98. doi: 10.1159/000135617. Epub 2008 May 29.
4.	Neuroglobin involvement in respiratory chain function and retinal ganglion cell integrity.	Lechauve C, etal., Biochim Biophys Acta. 2012 Dec;1823(12):2261-73. doi: 10.1016/j.bbamcr.2012.09.009. Epub 2012 Oct 2.
5.	Neuroglobin promotes neurite outgrowth via differential binding to PTEN and Akt.	Li L, etal., Mol Neurobiol. 2014 Feb;49(1):149-62. doi: 10.1007/s12035-013-8506-7. Epub 2013 Aug 1.
6.	Hypoxia differentially regulates the expression of neuroglobin and cytoglobin in rat brain.	Li RC, etal., Brain Res. 2006 Jun 22;1096(1):173-9. Epub 2006 Jun 5.
7.	Neuroglobin protects PC12 cells against oxidative stress.	Li RC, etal., Brain Res. 2008 Jan 23;1190:159-66. Epub 2007 Nov 22.
8.	Expression and cell distribution of neuroglobin in the brain tissue after experimental subarachnoid hemorrhage in rats: a pilot study.	Li WD, etal., Cell Mol Neurobiol. 2014 Mar;34(2):247-55. doi: 10.1007/s10571-013-0008-7. Epub 2013 Nov 27.
9.	[Expression of neuroglobin in rats with brain injury induced by LPS].	Liu C, etal., Zhonghua Shao Shang Za Zhi. 2009 Jun;25(3):222-6.
10.	Sleep deprivation reduces neuroglobin immunoreactivity in the rat brain.	Melgarejo-Gutierrez M, etal., Neuroreport. 2013 Feb 13;24(3):120-5. doi: 10.1097/WNR.0b013e32835d4b74.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	Resonance micro-Raman investigations of the rat medial preoptic nucleus: effects of a low-iron diet on the neuroglobin content.	Ramser K, etal., Appl Spectrosc. 2012 Dec;66(12):1454-60. doi: 10.1366/12-06670.
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Comprehensive gene review and curation	RGD comprehensive gene curation
18.	Neuroprotective effects of neuroglobin after mechanical injury.	Shang A, etal., Neurol Sci. 2012 Jun;33(3):551-8. doi: 10.1007/s10072-011-0772-4. Epub 2011 Sep 14.
19.	Expression of neuroglobin in ocular hypertension induced acute hypoxic-ischemic retinal injury in rats.	Shi SY, etal., Int J Ophthalmol. 2011;4(4):393-5. doi: 10.3980/j.issn.2222-3959.2011.04.14. Epub 2011 Aug 18.
20.	Effect of aging on neuroglobin expression in rodent brain.	Sun Y, etal., Neurobiol Aging. 2005 Feb;26(2):275-8.
21.	Neuroglobin protects the brain from experimental stroke in vivo.	Sun Y, etal., Proc Natl Acad Sci U S A. 2003 Mar 18;100(6):3497-500. Epub 2003 Mar 5.
22.	[Involvement of cerebral neuroglobin in electroacupuncture preconditioning-induced protection effect in cerebral ischemia-reperfusion rats].	Xie YN, etal., Zhen Ci Yan Jiu. 2012 Oct;37(5):380-4.
23.	Ibuprofen and lipoic acid conjugate neuroprotective activity is mediated by Ngb/Akt intracellular signaling pathway in Alzheimer's disease rat model.	Zara S, etal., Gerontology. 2013;59(3):250-60. doi: 10.1159/000346445. Epub 2013 Feb 20.
24.	Full-length cDNA cloning of human neuroglobin and tissue expression of rat neuroglobin.	Zhang C, etal., Biochem Biophys Res Commun 2002 Feb 8;290(5):1411-9.
25.	[Coding region cDNA sequence cloning of rat neuroglobin gene, its polymorphism feature and tissue expression profile analysis]	Zhang CG, etal., Yi Chuan Xue Bao 2001 Nov;28(11):997-1001.

Additional References at PubMed

PMID:8889548	PMID:11029004	PMID:15193759	PMID:16683692	PMID:16796995	PMID:17560688	PMID:17576199	PMID:18451642	PMID:19327369	PMID:19536481	PMID:20187147	PMID:20211612
PMID:20230802	PMID:20476562	PMID:21054965	PMID:21767627	PMID:22009023	PMID:22472608	PMID:22664218	PMID:22887765	PMID:23180278	PMID:23639750	PMID:23673310	PMID:24145836
PMID:24491879	PMID:24747803	PMID:25557405	PMID:25636685	PMID:26400308	PMID:26646387	PMID:26983282	PMID:28359933	PMID:28829495	PMID:29802248	PMID:32205448	PMID:35818200
PMID:36884214

Genomics

Comparative Map Data

Ngb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	106,744,378 - 106,749,830 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	106,744,378 - 106,749,830 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	106,912,130 - 106,917,574 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	107,210,967 - 107,216,411 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	106,580,643 - 106,586,085 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	111,126,259 - 111,131,699 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	111,126,261 - 111,132,320 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	120,412,241 - 120,417,508 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	111,231,188 - 111,236,255 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	111,234,718 - 111,239,786 (-)	NCBI
Celera	6	104,565,839 - 104,571,131 (-)	NCBI		Celera
Cytogenetic Map	6	q31	NCBI

NGB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	77,265,483 - 77,271,206 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	77,265,483 - 77,271,206 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	77,731,826 - 77,737,549 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	76,801,587 - 76,807,408 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	76,801,580 - 76,807,408	NCBI
Celera	14	57,770,473 - 57,776,215 (-)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	57,898,325 - 57,904,062 (-)	NCBI		HuRef
CHM1_1	14	77,671,361 - 77,677,104 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	71,474,790 - 71,480,551 (-)	NCBI		T2T-CHM13v2.0

Ngb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	87,144,305 - 87,149,313 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	87,144,305 - 87,149,313 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	87,097,531 - 87,102,539 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	87,097,531 - 87,102,539 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	88,438,481 - 88,443,489 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	87,986,634 - 87,991,642 (-)	NCBI		MGSCv36	mm8
Celera	12	88,562,002 - 88,567,162 (-)	NCBI		Celera
Cytogenetic Map	12	D2	NCBI
cM Map	12	41.29	NCBI

Ngb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	1,170,888 - 1,175,978 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	1,170,888 - 1,175,978 (-)	NCBI	ChiLan1.0	ChiLan1.0

NGB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	14	77,565,625 - 77,571,242 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	57,818,491 - 57,824,196 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	77,020,274 - 77,025,983 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	77,020,274 - 77,025,983 (-)	Ensembl	panpan1.1		panPan2

NGB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	50,081,960 - 50,086,071 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	50,081,960 - 50,085,435 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	49,769,803 - 49,773,792 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	50,314,590 - 50,325,270 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	50,315,118 - 50,319,630 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	49,978,294 - 49,982,287 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	50,001,322 - 50,005,311 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	50,399,520 - 50,403,524 (-)	NCBI		UU_Cfam_GSD_1.0

Ngb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	25,969,328 - 25,974,879 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	6,095,016 - 6,098,543 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	6,094,089 - 6,098,876 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NGB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	100,340,940 - 100,346,438 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	100,341,974 - 100,346,263 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	106,610,972 - 106,615,261 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NGB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	54,510,877 - 54,518,535 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	54,511,924 - 54,516,210 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	42,711,096 - 42,716,772 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ngb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	24,640,181 - 24,647,243 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	24,640,389 - 24,645,041 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ngb
38 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	480
Count of miRNA genes:	229
Interacting mature miRNAs:	276
Transcripts:	ENSRNOT00000016057
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat

Markers in Region

RH143985

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	106,744,474 - 106,744,593 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	111,126,356 - 111,126,474	NCBI	Rnor6.0
Rnor_5.0	6	120,412,338 - 120,412,456	UniSTS	Rnor5.0
RGSC_v3.4	6	111,231,284 - 111,231,402	UniSTS	RGSC3.4
Celera	6	104,565,936 - 104,566,054	UniSTS
RH 3.4 Map	6	743.6	UniSTS
Cytogenetic Map	6	q31	UniSTS

NGB

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	106,746,842 - 106,747,639 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	111,128,724 - 111,129,520	NCBI	Rnor6.0
Rnor_5.0	6	120,414,706 - 120,415,502	UniSTS	Rnor5.0
RGSC_v3.4	6	111,233,652 - 111,234,448	UniSTS	RGSC3.4
Celera	6	104,568,304 - 104,569,100	UniSTS
Cytogenetic Map	6	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									1
Low	3		13		5				61	22	36	11
Below cutoff		39	24	21	13	21	7	10	12	13	5		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_033359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB056655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB056656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF333245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF334379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY066001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF411002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB697453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT548175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016057 ⟹ ENSRNOP00000016057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	106,744,378 - 106,749,830 (-)	Ensembl
Rnor_6.0 Ensembl	6	111,126,261 - 111,132,320 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000081727 ⟹ ENSRNOP00000073109

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	111,127,246 - 111,131,271 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085112 ⟹ ENSRNOP00000072994

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	111,127,701 - 111,128,735 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108396 ⟹ ENSRNOP00000078847

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	106,746,925 - 106,749,830 (-)	Ensembl

RefSeq Acc Id:

NM_033359 ⟹ NP_203523

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	106,744,378 - 106,749,830 (-)	NCBI
Rnor_6.0	6	111,126,259 - 111,131,699 (-)	NCBI
Rnor_5.0	6	120,412,241 - 120,417,508 (-)	NCBI
RGSC_v3.4	6	111,231,188 - 111,236,255 (-)	RGD
Celera	6	104,565,839 - 104,571,131 (-)	NCBI

Sequence:

show sequence

GAAACAGCCCAGGGGCTCAGCAATTTCTGTTAGACTCTGAAGCCCGGACATTTCCCAGGCCTCG
GGTAGTCCCTAAGGCGGGTGCAGAGGGAGCGCGCAAGCCTCCCTGGGCCAGAGTGGGTGGGAGC
CACCGTAGCTTTAAAGGGCGGTTCTCTGGGAGCTTCGGGGTGCAGGGCGCAGCTGCCCAAGCGG
GGTCCCCGGAAGCGCCCGCGGCCAAGCTGGCCCTGCACATCCTCTGGGCTGGACCAGCAAAGAC
ACCGTTGCTGGGCCCCGCCCGACTAAGGCACTGGGCCTGGAGGGGGGCTCCCCCGCGTCTCCGA
GGAGATGGCGCTGCATGTGCGTTGACGCCGTGCCCACGCCTCGAGGGTCCCATCACTGCGTCCC
GCGACTCTCCTGGGAGAGAGAGAGTATGGAGCGCCTAGAGTCAGAGCTGATCCGGCAGAGCTGG
CGGGCAGTGAGCCGCAGCCCTCTGGAACATGGCACTGTCCTGTTCTCCAGGCTCTTCGCCCTGG
AACCCAGCCTGCTGCCTCTCTTCCAGTACAATGGCCGCCAGTTCTCCAGTCCTGAGGACTGTCT
CTCCTCTCCAGAATTCCTGGACCACATTAGGAAGGTTATGCTTGTGATTGATGCTGCTGTGACC
AACGTAGAGGACCTGTCTTCACTGGAGGAGTACCTGGCCACCTTGGGCAGGAAGCATCGGGCAG
TGGGAGTGAGGCTCAGCTCCTTCTCGACAGTAGGTGAGTCCCTGCTCTACATGCTGGAGAAGTG
CCTGGGTCCCGACTTTACGCCGGCTACAAGGACCGCCTGGAGCCAACTCTACGGAGCTGTGGTG
CAAGCCATGAGCCGAGGCTGGGACGGGGAGTAAGAGACAAGCCAGAGCCCCTATCTATGTGTGT
CTGTCTGTTGATCTGCCTGTTGTAGTCTTAGCCTCTCCCCCAGGGTCTCTCTGTACCTCAGTTC
TCATCCCCTTGGCCATCCAAGAGAGGTGATAGGAGAGGGCTGGCTCAGCTGCTGGTCCACAGCA
AGGAGGTGGATTTCCCTCCCTCATCCTCACAGATGCACTGCTGCAGGCCTGGTTAGCTCTCCCC
AGGAAGCAGAACAGTTTTGGTAGTGAGGAGGCATGGGGGTTCTTCTCCGAGAAGCTTTCTGTCA
AGGTGAGGGAAAAGCAAACTAGGCTTCTAGAATGTTCCATTTTGCCTGCCCAGTCTCTCTGATA
CTTTCCTGCCAGGCTGTTTACTTTCCAACGATGAAGGAGAGAGGCTTTAGTGTTTGTGGGGATC
TCAGGCAAGGGGAGCATGGAAGATGGCATTCTTCAGTGTCAGTGGGCACCCTGGGTCTCAGCTG
CTCAGATACCACACAAAACCTCTTATGCTCTTGGTTCGGCATTTCTGGTAGAAGCACCCCAATA
TTCTTTTTGGGGAAACCTCGCTGGCCAGCCAGAATGGAGAAGCCAGAAGGGCAAGGAAGAAGAG
TAACCTCATCCCATGGGGCCCTGAGTTCTGGGGCTCCTCCTGTCACCTTACTCTCACAGGGCTG
AATCCTGTCTCCACAGCCTCTTCTGCTCACCCGCCACTCTCCAGCTGCGGGCCCCTAAGTCTGT
GTTTAGCACTTGAAGTGGACCTGTGTCTGGGCAGATGAGCGAGAGCAAATAGAGTGGGAAGGGC
CCTTGTTCCCATTCCCAGACACCTACACTTTCTTGCTCTGTGCCGTGGTTCTGTAGACTCGCAA
AAAATAAACACGCTCTGTGTGCTGACCAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_203523	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG59898	(Get FASTA)	NCBI Sequence Viewer
	AAK15763	(Get FASTA)	NCBI Sequence Viewer
	AAL47568	(Get FASTA)	NCBI Sequence Viewer
	BAB39149	(Get FASTA)	NCBI Sequence Viewer
	BAB39150	(Get FASTA)	NCBI Sequence Viewer
	EDL81623	(Get FASTA)	NCBI Sequence Viewer
	EDL81624	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016057
	ENSRNOP00000016057.3
	ENSRNOP00000078847.1
GenBank Protein	Q99JA8	(Get FASTA)	NCBI Sequence Viewer
	SAI82222	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_203523 ⟸ NM_033359
- UniProtKB:	Q99N62 (UniProtKB/Swiss-Prot), Q8VH38 (UniProtKB/Swiss-Prot), Q99JA8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MERLESELIRQSWRAVSRSPLEHGTVLFSRLFALEPSLLPLFQYNGRQFSSPEDCLSSPEFLDH IRKVMLVIDAAVTNVEDLSSLEEYLATLGRKHRAVGVRLSSFSTVGESLLYMLEKCLGPDFTPA TRTAWSQLYGAVVQAMSRGWDGE hide sequence

RefSeq Acc Id:

ENSRNOP00000016057 ⟸ ENSRNOT00000016057

RefSeq Acc Id:

ENSRNOP00000072994 ⟸ ENSRNOT00000085112

RefSeq Acc Id:

ENSRNOP00000073109 ⟸ ENSRNOT00000081727

RefSeq Acc Id:

ENSRNOP00000078847 ⟸ ENSRNOT00000108396

Protein Domains

Globin family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99JA8-F1-model_v2	AlphaFold	Q99JA8	1-151	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621461	AgrOrtholog
BioCyc Gene	G2FUF-36728	BioCyc
Ensembl Genes	ENSRNOG00000011719	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016057	ENTREZGENE
	ENSRNOT00000016057.5	UniProtKB/TrEMBL
	ENSRNOT00000108396.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.490.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Globin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Globin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Globin/Proto	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:85382	UniProtKB/Swiss-Prot
NCBI Gene	85382	ENTREZGENE
PANTHER	BLR2807 PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROGLOBIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Globin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ngb	PhenoGen
PROSITE	GLOBIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011719	RatGTEx
Superfamily-SCOP	SSF46458	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JSL1_RAT	UniProtKB/TrEMBL
	A0A8I5ZM27_RAT	UniProtKB/TrEMBL
	A6JE79_RAT	UniProtKB/TrEMBL
	A6JE80_RAT	UniProtKB/TrEMBL
	NGB_RAT	UniProtKB/Swiss-Prot
	Q8VH38	ENTREZGENE
	Q99JA8	ENTREZGENE
	Q99N62	ENTREZGENE
UniProt Secondary	Q8VH38	UniProtKB/Swiss-Prot
	Q99N62	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Ngb	neuroglobin			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Ngb	neuroglobin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in cerebral cortex, hippocampus, thalamus, hypothalamus, olfactory bulb, and cerebellum	625434
gene_protein	151 amino acid protein	729218

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD