Arr3 (arrestin 3) - Rat Genome Database

Name: Arr3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Arr3 (arrestin 3) Rattus norvegicus

Analyze

Symbol:

Arr3

Name:

arrestin 3

RGD ID:

621385

Description:

Enables protein domain specific binding activity. Predicted to be involved in negative regulation of signal transduction. Predicted to act upstream of or within endocytosis and regulation of protein phosphorylation. Predicted to be located in photoreceptor inner segment; photoreceptor outer segment; and synapse. Human ortholog(s) of this gene implicated in myopia. Orthologous to human ARR3 (arrestin 3); PARTICIPATES IN eicosanoid signaling pathway; visual phototransduction pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

arrestin 3, retinal; arrestin 3, retinal (X-arrestin); arrestin-C; cArr; cone arrestin; retinal cone arrestin-3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARR3 (arrestin 3)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):	Arr3 (arrestin 3, retinal)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arr3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARR3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARR3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arr3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARR3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARR3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arr3 (arrestin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ARR3 (arrestin 3)	Alliance	DIOPT (HGNC\|OrthoFinder\|PhylomeDB)
Mus musculus (house mouse):	Arr3 (arrestin 3, retinal)	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	arr3b (arrestin 3b, retinal (X-arrestin))	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	arr3a (arrestin 3a, retinal (X-arrestin))	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	arr3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	X	65,699,881 - 65,712,224 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	65,698,699 - 65,712,153 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	67,183,297 - 67,195,639 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	70,683,687 - 70,696,028 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	68,244,588 - 68,256,931 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	70,438,590 - 70,452,140 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	70,438,617 - 70,452,067 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	71,310,209 - 71,323,756 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	88,602,380 - 88,614,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	88,684,283 - 88,688,153 (+)	NCBI
Celera	X	66,058,741 - 66,071,082 (+)	NCBI		Celera
Cytogenetic Map	X	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

epilepsy (ISO)

genetic disease (ISO)

Myopia 26, X-Linked, Female-Limited (ISO)

syndromic microphthalmia 5 (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

D-mannitol (ISO)

genistein (EXP)

gentamycin (EXP)

methoxychlor (EXP)

paclitaxel (ISO)

paracetamol (ISO)

propiconazole (ISO)

silicon dioxide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endocytosis (IEA,ISO)

negative regulation of signal transduction (TAS)

regulation of protein phosphorylation (IEA,ISO)

signal transduction (IEA)

visual perception (IEA)

Cellular Component

photoreceptor inner segment (IEA,ISO)

photoreceptor outer segment (IEA,ISO)

synapse (IEA,ISO)

Molecular Function

opsin binding (IEA,ISO)

phosphoprotein binding (IEA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway (ISO)

visual phototransduction pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Photoreceptor signaling: supporting vision across a wide range of light intensities.	Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
2.	Identification of quantitative trait Loci for anxiety and locomotion phenotypes in rat recombinant inbred strains.	Conti LH, etal., Behav Genet 2004 Jan;34(1):93-103.
3.	Cone arrestin identified by targeting expression of a functional family.	Craft CM, etal., J Biol Chem 1994 Feb 11;269(6):4613-9.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	The functional cycle of visual arrestins in photoreceptor cells.	Gurevich VV, etal., Prog Retin Eye Res. 2011 Nov;30(6):405-30. Epub 2011 Jul 29.
7.	Identification of a short linear sequence present in the C-terminal tail of the rat follitropin receptor that modulates arrestin-3 binding in a phosphorylation-independent fashion.	Kishi H, etal., J Biol Chem 2002 Jun 14;277(24):21939-46.
8.	Loss of intracellular dystrophin: a potential mechanism for myocardial reperfusion injury.	Kyoi S, etal., Circ J. 2003 Aug;67(8):725-7.
9.	Preferential Interaction between the dopamine D2 receptor and Arrestin2 in neostriatal neurons.	Macey TA, etal., Mol Pharmacol. 2004 Dec;66(6):1635-42. Epub 2004 Sep 10.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10725384	PMID:12486395	PMID:15218143	PMID:22159081	PMID:23139825	PMID:23704327	PMID:25972452	PMID:31080119

Genomics

Comparative Map Data

Arr3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	X	65,699,881 - 65,712,224 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	65,698,699 - 65,712,153 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	67,183,297 - 67,195,639 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	70,683,687 - 70,696,028 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	68,244,588 - 68,256,931 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	70,438,590 - 70,452,140 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	70,438,617 - 70,452,067 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	71,310,209 - 71,323,756 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	88,602,380 - 88,614,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	88,684,283 - 88,688,153 (+)	NCBI
Celera	X	66,058,741 - 66,071,082 (+)	NCBI		Celera
Cytogenetic Map	X	q22	NCBI

ARR3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	70,268,334 - 70,281,883 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	70,268,305 - 70,281,840 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	69,488,184 - 69,501,690 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	69,404,910 - 69,418,415 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	69,271,222 - 69,284,711	NCBI
Celera	X	69,841,522 - 69,855,024 (+)	NCBI		Celera
Cytogenetic Map	X	q13.1	NCBI
HuRef	X	63,309,253 - 63,322,604 (+)	NCBI		HuRef
CHM1_1	X	69,382,163 - 69,395,648 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	68,701,653 - 68,715,201 (+)	NCBI		T2T-CHM13v2.0

Arr3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	99,649,086 - 99,662,099 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	99,649,103 - 99,662,099 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	100,605,480 - 100,618,493 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	100,605,497 - 100,618,493 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	97,800,836 - 97,813,832 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	96,808,275 - 96,821,212 (+)	NCBI		MGSCv36	mm8
Celera	X	87,531,523 - 87,544,518 (+)	NCBI		Celera
Cytogenetic Map	X	C3	NCBI
cM Map	X	43.72	NCBI

Arr3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955475	9,819,792 - 9,835,200 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955475	9,819,783 - 9,835,526 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARR3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	X	69,949,236 - 69,962,712 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	59,536,796 - 59,550,274 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	69,596,163 - 69,609,624 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	69,596,163 - 69,609,624 (+)	Ensembl	panpan1.1		panPan2

ARR3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	54,725,034 - 54,730,920 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	54,718,323 - 54,730,852 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	45,544,260 - 45,556,911 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	55,684,406 - 55,697,072 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	55,684,472 - 55,697,004 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	53,653,383 - 53,666,039 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	54,984,189 - 54,997,103 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	54,911,364 - 54,924,024 (+)	NCBI		UU_Cfam_GSD_1.0

Arr3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	47,432,077 - 47,445,740 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936762	1,194,166 - 1,208,844 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936762	1,194,251 - 1,207,914 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARR3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	56,296,596 - 56,310,506 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	56,295,107 - 56,310,507 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	63,491,381 - 63,505,290 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARR3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	60,111,875 - 60,127,144 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	60,114,643 - 60,127,255 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	1,958,268 - 1,971,777 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arr3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624903	246,888 - 255,169 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arr3
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	31
Interacting mature miRNAs:	32
Transcripts:	ENSRNOT00000003946
Prediction methods:	Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat
738035	Stresp1	Stress response QTL 1	4.96	0.000011	stress-related behavior trait (VT:0010451)	defensive burying - coping	X	41304447	112935181	Rat
61431	Cia19	Collagen induced arthritis QTL 19	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	65612192	120568734	Rat

Markers in Region

AI233013

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	65,704,232 - 65,704,340 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	70,444,149 - 70,444,256	NCBI	Rnor6.0
Rnor_5.0	X	71,315,767 - 71,315,874	UniSTS	Rnor5.0
RGSC_v3.4	X	88,606,732 - 88,606,839	UniSTS	RGSC3.4
Celera	X	66,063,093 - 66,063,200	UniSTS
Cytogenetic Map	X	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium											2
Low	3	11	25	9	19	9	8	9	15	11	7	11	8
Below cutoff		16	2	2		2		2	2		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001190993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006257053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U03628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003946 ⟹ ENSRNOP00000003946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	65,699,881 - 65,712,124 (+)	Ensembl
Rnor_6.0 Ensembl	X	70,440,059 - 70,452,038 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000076264

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	X	70,445,516 - 70,446,687 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000076671 ⟹ ENSRNOP00000068038

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	65,698,699 - 65,712,153 (+)	Ensembl
Rnor_6.0 Ensembl	X	70,438,617 - 70,452,067 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000114787 ⟹ ENSRNOP00000087483

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	65,700,140 - 65,712,124 (+)	Ensembl

RefSeq Acc Id:

NM_001190993 ⟹ NP_001177922

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	X	65,699,881 - 65,712,224 (+)	NCBI
Rnor_6.0	X	70,439,797 - 70,452,138 (+)	NCBI
Rnor_5.0	X	71,310,209 - 71,323,756 (+)	NCBI
Celera	X	66,058,741 - 66,071,082 (+)	NCBI

Sequence:

show sequence

ATGTCCACAGTGTTTAAAAAGACTAGCTCCAATGGGAAGTTTTCCATCTACCTGGGGAAACGAG
ACTTCGTGGATGATGTGGACACAGTGGAGCCCATTGATGGAGTAATCCTTGTTGACCCTGAGTA
CCTAAAAGGTCGAAAGATGTTTGTCAGGTTGACATGTGCTTTTCGCTATGGCCGTGATGACTTG
GATGTGATTGGTCTGACATTTCGCAAAGACCTCTATGTACAGACCAAACAAGTGGCTCCTGCTG
AACCCACCAGCATCCAGGGTCCCCTCACAGCCTTACAGGAGCGGCTTCTACACAAGCTTGGGGT
CAATGCCTATCCTTTTACACTTCAGATGGTTGCTAACCTGCCCTGTTCAGTAACACTGCAGCCT
GGGCCTGAAGATTCAGGAAAGCCCTGTGGGGTTGACTTTGAAGTGAAGAGTTTCTGTGCAGAAA
ATCTGGAAGAGAAAATCTCTAAGAGTGATTCTGTGCAGCTGGTTGTACGGAAAGTACAGTTTTC
AGCCCTGGAACCAGGCCCTGGTCCCTGGGCACAGACCATTCGCAGCTTCTTTCTGTCATCTCAG
CCCCTTCAACTCCAGGCCTGGATGGACAGGGAGGTTCATTACCATGGAGAAGCTATTTCTGTAC
ACGTTTCTATCAACAACTATACCAACAAGGTCATCAGAAGAATCAAGATTGCAGTTATCCAGAT
CACAGATGTTGTCCTGTATTCACTAGACAAGTACACAAAGACTGTGTTCATTCGGGAGTTCACA
GAGACAGTAGCTGCTAACTCCAGCTTCTCCCAGACCTTTGCAGTAACCCCACTCCTGGCTGCCA
ACCGTCAGAAGCAGGGCCTGGCACTGGATGGCAAACTCAAGCATGAAGACACCAATCTGGCCTC
TAGCACAATTCTTCGACCTGGAATGAACAAGGAGCTACTGGGGATCCTGGTGTCCTACAAAGTT
AAAGTCAACTTGATGGTGTCCTATGGGGGCATTCTAGGAGGTCTGCCAGCCAGTGATGTTGGTG
TGGAGCTCCCCCTGATCTTGATCCATCCAAAGCCACCTCACGGTGAGAGAGCAGTGGCTACCAG
CTCGGAGGACATAGTTGTCGAAGAGTTTATGCAGCAGAACAGCCAGACACAAAGCTAGAAAGCT
CCAACAGCAGACACAGTTAAGAGCCGATAGTCATCTCTGATAATTCTGTGTGGAAGCCCCTGTT
GTAACACTCTAATAAAAGGTTTTGTCTGGA

hide sequence

RefSeq Acc Id:

XM_039099437 ⟹ XP_038955365

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	X	65,701,878 - 65,712,224 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001177922	(Get FASTA)	NCBI Sequence Viewer
	XP_038955365	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA17552	(Get FASTA)	NCBI Sequence Viewer
	EDL95933	(Get FASTA)	NCBI Sequence Viewer
	P36576	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001177922 ⟸ NM_001190993

- UniProtKB:

A0A096MJ89 (UniProtKB/TrEMBL), F1LMR6 (UniProtKB/TrEMBL), A6IQ79 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSTVFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVILVDPEYLKGRKMFVRLTCAFRYGRDDL
DVIGLTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQP
GPEDSGKPCGVDFEVKSFCAENLEEKISKSDSVQLVVRKVQFSALEPGPGPWAQTIRSFFLSSQ
PLQLQAWMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVIQITDVVLYSLDKYTKTVFIREFT
ETVAANSSFSQTFAVTPLLAANRQKQGLALDGKLKHEDTNLASSTILRPGMNKELLGILVSYKV
KVNLMVSYGGILGGLPASDVGVELPLILIHPKPPHGERAVATSSEDIVVEEFMQQNSQTQS

hide sequence

RefSeq Acc Id:

ENSRNOP00000003946 ⟸ ENSRNOT00000003946

RefSeq Acc Id:

ENSRNOP00000068038 ⟸ ENSRNOT00000076671

RefSeq Acc Id:	XP_038955365 ⟸ XM_039099437
- Peptide Label:	isoform X1
- UniProtKB:	A6IQ79 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000087483 ⟸ ENSRNOT00000114787

Protein Domains

Arrestin C-terminal-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P36576-F1-model_v2	AlphaFold	P36576	1-92	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621385	AgrOrtholog
BioCyc Gene	G2FUF-2129	BioCyc
Ensembl Genes	ENSRNOG00000002904	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000003946	ENTREZGENE
	ENSRNOP00000003946.4	UniProtKB/TrEMBL
	ENSRNOP00000068038.2	UniProtKB/TrEMBL
	ENSRNOP00000087483.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000003946	ENTREZGENE
	ENSRNOT00000003946.5	UniProtKB/TrEMBL
	ENSRNOT00000076671.3	UniProtKB/TrEMBL
	ENSRNOT00000114787.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.640	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.40.840	UniProtKB/TrEMBL
InterPro	Arrestin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin-like_C	UniProtKB/TrEMBL
	Arrestin-like_N	UniProtKB/TrEMBL
	Arrestin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin_CS	UniProtKB/TrEMBL
	Arrestin_N	UniProtKB/TrEMBL
	Ig_E-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171107	UniProtKB/TrEMBL
NCBI Gene	171107	ENTREZGENE
PANTHER	PTHR11792	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11792:SF19	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Arrestin_C	UniProtKB/TrEMBL
	Arrestin_N	UniProtKB/TrEMBL
PhenoGen	Arr3	PhenoGen
PRINTS	ARRESTIN	UniProtKB/TrEMBL
PROSITE	ARRESTINS	UniProtKB/TrEMBL
SMART	Arrestin_C	UniProtKB/TrEMBL
Superfamily-SCOP	SSF81296	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A096MJ89	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A8Q4_RAT	UniProtKB/TrEMBL
	A6IQ79	ENTREZGENE, UniProtKB/TrEMBL
	ARRC_RAT	UniProtKB/Swiss-Prot
	F1LMR6	ENTREZGENE, UniProtKB/TrEMBL
	P36576	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-21	Arr3	arrestin 3	Arr3	arrestin 3, retinal (X-arrestin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Arr3	arrestin 3, retinal (X-arrestin)	Arr3	arrestin 3, retinal	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Arr3	arrestin 3, retinal		arrestin 3, retinal (X-arrestin)	Name updated	1299863	APPROVED
2002-08-07	Arr3	arrestin 3, retinal (X-arrestin)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	human homolog located at X chromosome, may be candidate for several inherited X-linked retinopathies	727257
gene_expression	present in the retina with cone photoreceptors and in the pineal to a subpopulation of pinealocytes	727257
gene_function	binds to cone-related G-protein-coupled receptors	727257

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)