Atp5po (ATP synthase peripheral stalk subunit OSCP)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Atp5po (ATP synthase peripheral stalk subunit OSCP) Rattus norvegicus

Analyze

Symbol:

Atp5po

Name:

ATP synthase peripheral stalk subunit OSCP

RGD ID:

621379

Description:

Enables estradiol binding activity. Contributes to ATP hydrolysis activity. Involved in ATP biosynthetic process; cellular response to cAMP; and cellular response to cytokine stimulus. Located in cell surface; mitochondrion; and plasma membrane. Part of mitochondrial proton-transporting ATP synthase complex, coupling factor F(o). Biomarker of hypothyroidism. Orthologous to human ATP5PO (ATP synthase peripheral stalk subunit OSCP); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 17beta-estradiol; 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP synthase subunit O, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (oligomycin sensitivity conferring protein); Atp5o; Atpo; MGC72688; oligomycin sensitivity conferral protein; Oscp; sperm flagella protein 4

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	31,165,218 - 31,171,530 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	31,165,217 - 31,171,592 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	39,859,129 - 39,865,430 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	11	32,530,562 - 32,536,864 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	11	31,693,130 - 31,699,440 (-)	NCBI	Rnor_WKY
Rnor_6.0	11	32,081,606 - 32,087,918 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	32,081,574 - 32,088,002 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	35,685,316 - 35,691,628 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	31,914,320 - 31,920,632 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	31,953,218 - 31,959,531 (-)	NCBI
Celera	11	30,824,784 - 30,831,095 (-)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis type 1 (ISO)

autosomal dominant intellectual developmental disorder 7 (ISO)

clear cell renal cell carcinoma (ISO)

epilepsy (ISO)

Fluoride Poisoning (IEP)

hypothyroidism (IEP)

immunodeficiency 28 (ISO)

inflammatory bowel disease 25 (ISO)

Leigh disease (ISO)

myocardial infarction (ISO)

Parkinson's disease 20 (ISO)

Subacute Necrotizing Encephalopathy of Leigh, Infantile (ISO)

ZTTK Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

5-formyltetrahydrofolic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

Brodifacoum (EXP)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

cisplatin (EXP)

clobetasol (ISO)

clofibrate (EXP)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

dihydroartemisinin (ISO)

doxorubicin (ISO)

etoposide (ISO)

flavonoids (EXP)

flutamide (EXP,ISO)

folic acid (ISO)

genistein (EXP)

gentamycin (EXP)

irinotecan (ISO)

isoprenaline (EXP)

ivermectin (ISO)

josamycin (ISO)

lamivudine (ISO)

lead(0) (ISO)

lead(2+) (ISO)

menadione (ISO)

methapyrilene (ISO)

N-nitrosodiethylamine (EXP)

Nonylphenol (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

phenobarbital (EXP)

picrotoxin (EXP)

resveratrol (ISO)

rotenone (ISO)

sarin (ISO)

sodium arsenite (EXP)

Soman (EXP)

streptozocin (EXP)

tamoxifen (ISO)

thioacetamide (EXP)

tolcapone (EXP)

tungsten (ISO)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

vinclozolin (EXP)

zidovudine (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ATP biosynthetic process (IGI)

ATP metabolic process (IDA)

cellular response to cAMP (IEP)

cellular response to cytokine stimulus (IEP)

proton motive force-driven ATP synthesis (IEA)

proton motive force-driven mitochondrial ATP synthesis (IBA,ISO)

proton transmembrane transport (IEA)

Cellular Component

cell surface (IDA)

mitochondrial inner membrane (IEA)

mitochondrial proton-transporting ATP synthase complex (IDA,ISO)

mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) (IDA)

mitochondrial proton-transporting ATP synthase, stator stalk (IBA)

mitochondrion (IDA)

mitochondrion (ISO)

plasma membrane (IDA)

plasma membrane (ISO)

proton-transporting ATP synthase complex, catalytic core F(1) (IBA)

Molecular Function

ATP hydrolysis activity (IDA)

estradiol binding (IDA)

protein binding (ISO)

protein-containing complex binding (IDA)

proton-transporting ATP synthase activity, rotational mechanism (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Hypothyroidism leads to a decreased expression of mitochondrial F0F1-ATP synthase in rat liver.	null
2.	Systematic Analysis of the Expression of the Mitochondrial ATP Synthase (Complex V) Subunits in Clear Cell Renal Cell Carcinoma.	Brüggemann M, etal., Transl Oncol. 2017 Aug;10(4):661-668. doi: 10.1016/j.tranon.2017.06.002. Epub 2017 Jun 30.
3.	F1FO ATP Synthase Is Expressed at the Surface of Embryonic Rat Heart-Derived H9c2 Cells and Is Affected by Cardiac-Like Differentiation.	Comelli M, etal., J Cell Biochem. 2016 Feb;117(2):470-82. doi: 10.1002/jcb.25295.
4.	cAMP regulates the functional activity, coupling efficiency and structural organization of mammalian FOF1 ATP synthase.	De Rasmo D, etal., Biochim Biophys Acta. 2016 Apr;1857(4):350-8. doi: 10.1016/j.bbabio.2016.01.006. Epub 2016 Jan 13.
5.	Cyclophilin D deficiency attenuates mitochondrial F1Fo ATP synthase dysfunction via OSCP in Alzheimer's disease.	Gauba E, etal., Neurobiol Dis. 2019 Jan;121:138-147. doi: 10.1016/j.nbd.2018.09.020. Epub 2018 Sep 26.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	The oligomycin sensitivity conferring protein of rat liver mitochondrial ATP synthase: arginine 94 is important for the binding of OSCP to F1.	Golden TR and Pedersen PL, Biochemistry. 1998 Sep 29;37(39):13871-81.
8.	Molecular cloning and sequence of cDNAs for the import precursors of oligomycin sensitivity conferring protein, ATPase inhibitor protein, and subunit c of H(+)-ATP synthase in rat mitochondria.	Higuti T, etal., Biochim Biophys Acta 1993 Mar 20;1172(3):311-4.
9.	TNF-like weak inducer of apoptosis aggravates left ventricular dysfunction after myocardial infarction in mice.	Jarr KU, etal., Mediators Inflamm. 2014;2014:131950. doi: 10.1155/2014/131950. Epub 2014 Feb 20.
10.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
11.	Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).	Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
12.	Structural and functional characterization of F(o)F(1)-ATP synthase on the extracellular surface of rat hepatocytes.	Mangiullo R, etal., Biochim Biophys Acta. 2008 Oct;1777(10):1326-35. doi: 10.1016/j.bbabio.2008.08.003. Epub 2008 Aug 15.
13.	3,5-diiodo-L-thyronine upregulates rat-liver mitochondrial F(o)F(1)-ATP synthase by GA-binding protein/nuclear respiratory factor-2.	Mangiullo R, etal., Biochim Biophys Acta. 2010 Feb;1797(2):233-40. doi: 10.1016/j.bbabio.2009.10.009. Epub 2009 Oct 28.
14.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
15.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	The functional expression of a rat cDNA encoding OSCP in the yeast Saccharomyces cerevisiae.	Prescott M, etal., Biochem Biophys Res Commun. 1995 Feb 27;207(3):943-9. doi: 10.1006/bbrc.1995.1276.
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	PFOS prenatal exposure induce mitochondrial injury and gene expression change in hearts of weaned SD rats.	Xia W, etal., Toxicology. 2011 Mar 28;282(1-2):23-9. Epub 2011 Jan 18.
23.	Purification and identification of an estrogen binding protein from rat brain: oligomycin sensitivity-conferring protein (OSCP), a subunit of mitochondrial F0F1-ATP synthase/ATPase.	Zheng J and Ramirez VD, J Steroid Biochem Mol Biol 1999 Jan;68(1-2):65-75.

Additional References at PubMed

PMID:12110673	PMID:12477932	PMID:14651853	PMID:15489334	PMID:15850986	PMID:17634366	PMID:17851741	PMID:18614015	PMID:20833797	PMID:21630459	PMID:23376485	PMID:23979707
PMID:24625528	PMID:29476059	PMID:32357304

Genomics

Comparative Map Data

Atp5po
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	31,165,218 - 31,171,530 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	31,165,217 - 31,171,592 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	39,859,129 - 39,865,430 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	11	32,530,562 - 32,536,864 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	11	31,693,130 - 31,699,440 (-)	NCBI	Rnor_WKY
Rnor_6.0	11	32,081,606 - 32,087,918 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	32,081,574 - 32,088,002 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	35,685,316 - 35,691,628 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	31,914,320 - 31,920,632 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	31,953,218 - 31,959,531 (-)	NCBI
Celera	11	30,824,784 - 30,831,095 (-)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

ATP5PO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	33,903,453 - 33,915,804 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	21	33,903,453 - 33,915,814 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	35,275,757 - 35,288,108 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	34,197,627 - 34,210,028 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	34,197,627 - 34,210,028	NCBI
Celera	21	20,475,343 - 20,487,744 (-)	NCBI		Celera
Cytogenetic Map	21	q22.11	ENTREZGENE
HuRef	21	20,753,820 - 20,766,232 (-)	NCBI		HuRef
CHM1_1	21	34,838,231 - 34,850,633 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	32,285,156 - 32,297,516 (-)	NCBI		T2T-CHM13v2.0

Atp5o
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	91,722,111 - 91,728,518 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	91,722,102 - 91,728,575 (-)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	16	91,481,286 - 91,723,870 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	91,925,223 - 91,931,630 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	91,925,214 - 91,931,687 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	16	91,684,398 - 91,926,982 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	91,925,468 - 91,931,875 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	91,814,082 - 91,820,489 (-)	NCBI		MGSCv36	mm8
Celera	16	93,009,520 - 93,015,922 (-)	NCBI		Celera
Cytogenetic Map	16	C4	NCBI

Atp5po
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	33,286,178 - 33,299,420 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	33,288,194 - 33,298,817 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATP5PO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	21	33,640,394 - 33,652,891 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	21	20,270,442 - 20,282,865 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ATP5PO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	28,472,106 - 28,481,759 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	28,469,812 - 28,479,442 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	28,677,289 - 28,686,884 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	28,677,286 - 28,686,848 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	28,543,896 - 28,553,521 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	28,558,342 - 28,567,972 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	29,057,680 - 29,067,316 (-)	NCBI		UU_Cfam_GSD_1.0

Atp5po
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	29,013,129 - 29,023,172 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	8,444,546 - 8,456,048 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936500	8,444,681 - 8,454,694 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5PO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	197,509,331 - 197,519,588 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	197,509,331 - 197,519,530 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	207,336,292 - 207,346,559 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5PO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	58,273,181 - 58,285,615 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666071	777,701 - 790,247 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5po
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	22,064,441 - 22,074,773 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	22,064,438 - 22,074,753 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp5po
44 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	66
Count of miRNA genes:	58
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000002732
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598842	Glom10	Glomerulus QTL 10	3.4		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	1	35331169	Rat
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	16472047	44285911	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat

Markers in Region

RH140852

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	31,165,236 - 31,165,582 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	32,081,625 - 32,081,970	NCBI	Rnor6.0
Rnor_5.0	11	35,685,335 - 35,685,680	UniSTS	Rnor5.0
RGSC_v3.4	11	31,914,339 - 31,914,684	UniSTS	RGSC3.4
Celera	11	30,824,803 - 30,825,148	UniSTS
Cytogenetic Map	11	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		19								2
Medium	3	30	57	41	19	41	8	11	74	33	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000002732 ⟹ ENSRNOP00000002732

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	31,165,226 - 31,171,592 (-)	Ensembl
Rnor_6.0 Ensembl	11	32,081,574 - 32,088,002 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105272 ⟹ ENSRNOP00000079398

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	31,165,217 - 31,170,987 (-)	Ensembl

RefSeq Acc Id:

NM_138883 ⟹ NP_620238

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	11	31,165,218 - 31,171,530 (-)	NCBI
Rnor_6.0	11	32,081,606 - 32,087,918 (-)	NCBI
Rnor_5.0	11	35,685,316 - 35,691,628 (-)	NCBI
RGSC_v3.4	11	31,914,320 - 31,920,632 (-)	RGD
Celera	11	30,824,784 - 30,831,095 (-)	RGD

Sequence:

show sequence

AAAGATGGCCGCACCAGCAACATCCGTGCTGTCCCGACAGGTGCGGAGTTTCAGCACATCTGTG
GTCAGGCCCTTTTCGAAGCTTGTAAGGCCCCCTGTCCAGGTCTACGGCATCGAAGGCCGCTATG
CAACCGCCCTGTACTCTGCTGCGTCTAAGCAGAAAAGGCTGGACCAGGTGGAAAAGGAGTTGCT
GCGAGTGGGGCAACTCTTGAAGGACCCCAAGGTGTCCCTTGCTGTTCTGAACCCCTACATTAAG
CGCTCCATCAAAGTGAAAAGCCTGAAGGACATCACTACAAAGGAAAAATTCTCTCCGCTGACGG
CCAACCTCATGAATTTACTTGCTGAAAATGGTCGCCTAGGCAACACCCAGGGCGTCATCTCTGC
CTTCTCCACCATCATGAGTGTCCACCGTGGAGAAGTGCCGTGCACAGTGACCACAGCGTTTCCT
TTAGATGAAGCTGTTCTCTCTGAGTTAAAGACAGTGCTGAATAGCTTCCTGAGTAAAGGCCAGA
TACTGAACCTGGAGGTCAAGACTGACCCATCAATCATGGGTGGGATGATTGTCCGAATTGGAGA
GAAATACGTTGATATGTCTGCAAAGAGCAAGATTCAGAAGCTCAGCAAGGCCATGCGGGATCTG
CTCTGAGAGACTGTCACCTGTGTGAGCGCTTGTCTTTGGAGCACAATAAAATGCTTCCTGAACA
GAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_620238	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60544	(Get FASTA)	NCBI Sequence Viewer
	BAA02429	(Get FASTA)	NCBI Sequence Viewer
	EDM10742	(Get FASTA)	NCBI Sequence Viewer
	EDM10743	(Get FASTA)	NCBI Sequence Viewer
	EDM10744	(Get FASTA)	NCBI Sequence Viewer
	EDM10745	(Get FASTA)	NCBI Sequence Viewer
	EDM10746	(Get FASTA)	NCBI Sequence Viewer
	EDM10747	(Get FASTA)	NCBI Sequence Viewer
	EDM10748	(Get FASTA)	NCBI Sequence Viewer
	Q06647	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_620238 ⟸ NM_138883
- Peptide Label:	precursor
- UniProtKB:	Q06647 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAAPATSVLSRQVRSFSTSVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQKRLDQVEKELLR VGQLLKDPKVSLAVLNPYIKRSIKVKSLKDITTKEKFSPLTANLMNLLAENGRLGNTQGVISAF STIMSVHRGEVPCTVTTAFPLDEAVLSELKTVLNSFLSKGQILNLEVKTDPSIMGGMIVRIGEK YVDMSAKSKIQKLSKAMRDLL hide sequence

RefSeq Acc Id:

ENSRNOP00000002732 ⟸ ENSRNOT00000002732

RefSeq Acc Id:

ENSRNOP00000079398 ⟸ ENSRNOT00000105272

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q06647-F1-model_v2	AlphaFold	Q06647	1-213	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698063

Promoter ID:

EPDNEW_R8588

Type:

initiation region

Name:

Atp5po_1

Description:

ATP synthase peripheral stalk subunit OSCP

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	32,087,930 - 32,087,990	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621379	AgrOrtholog
BioCyc Gene	G2FUF-21873	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000001991	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000002732	ENTREZGENE
	ENSRNOP00000002732.3	UniProtKB/Swiss-Prot
	ENSRNOP00000079398.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002732	ENTREZGENE
	ENSRNOT00000002732.7	UniProtKB/Swiss-Prot
	ENSRNOT00000105272.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.520.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6918775	IMAGE-MGC_LOAD
InterPro	ATP_synth_OSCP/delta_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_OSCP/d_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_OSCP/dsu	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:192241	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72688	IMAGE-MGC_LOAD
NCBI Gene	192241	ENTREZGENE
PANTHER	ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11910	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	OSCP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Atp5po	PhenoGen
PRINTS	ATPASEDELTA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ATPASE_DELTA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGRFAMs	ATP_synt_delta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZMM6_RAT	UniProtKB/TrEMBL
	ATPO_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-12-01	Atp5po	ATP synthase peripheral stalk subunit OSCP	Atp5o	ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Atp5o	ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit		ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (oligomycin sensitivity conferring protein)	Name updated	1299863	APPROVED
2002-08-07	Atp5o	ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (oligomycin sensitivity conferring protein)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)