Advanced Search (OLGA)

Gene: Tex101 (testis expressed 101) Rattus norvegicus

Analyze

Symbol:

Tex101

Name:

testis expressed 101

RGD ID:

621373

Description:

Involved in basophil activation and regulation of cytosolic calcium ion concentration. Located in cell surface. Orthologous to human TEX101 (testis expressed 101); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-Tetrachlorodibenzofuran; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

lipid raft-associated glycoprotein TEC-21; LOC100911185; Tec21; testis expressed gene 101; testis-expressed protein 101; testis-expressed sequence 101 protein; testis-expressed sequence 101 protein-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TEX101 (testis expressed 101)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Tex101 (testis expressed gene 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tex101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TEX101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TEX101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tex101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TEX101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TEX101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tex101 (testis expressed 101)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Tex101 (testis expressed gene 101)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TEX101 (testis expressed 101)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,382,974 - 89,387,340 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	89,382,974 - 89,387,340 (-)	Ensembl				GRCr8
mRatBN7.2	1	80,255,076 - 80,259,442 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,255,076 - 80,259,442 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	85,646,992 - 85,651,359 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,198,491 - 94,202,857 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,402,749 - 87,407,116 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,529,776 - 81,534,149 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,529,781 - 81,534,140 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	82,787,105 - 82,791,476 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	79,946,338 - 79,949,053 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	74,707,230 - 74,709,945 (-)	NCBI		Celera
RGSC_v3.1	1	80,024,449 - 80,027,164 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

chromium(6+) (ISO)

cisplatin (ISO)

diethylstilbestrol (EXP)

lead diacetate (ISO)

manganese(II) chloride (EXP)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (ISO)

paracetamol (ISO)

resveratrol (ISO)

styrene (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

basophil activation (IDA)

binding of sperm to zona pellucida (IBA,IEA,ISO,ISS)

fertilization (IEA,ISO,ISS)

flagellated sperm motility (IEA,ISO,ISS)

regulation of cytosolic calcium ion concentration (IDA)

regulation of flagellated sperm motility (IBA,IEA,ISO,ISS)

Cellular Component

acrosomal membrane (IEA,ISO)

acrosomal vesicle (IEA,ISO,ISS)

cell surface (IDA)

cytoplasmic vesicle (IEA)

extracellular region (IEA,ISO,ISS)

membrane (IEA)

membrane raft (IEA)

plasma membrane (IEA,ISO,ISS)

plasma membrane raft (IBA)

side of membrane (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	New monoclonal antibodies to rat testicular antigen, TEC-21.	Halova I, etal., Folia Biol (Praha) 2001;47(5):180-2.
3.	A novel lipid raft-associated glycoprotein, TEC-21, activates rat basophilic leukemia cells independently of the type 1 Fc epsilon receptor.	Halova I, etal., Int Immunol 2002 Feb;14(2):213-23.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16822331	PMID:18503752	PMID:18620756	PMID:19144954	PMID:21724266	PMID:23633567	PMID:23969891	PMID:27005865

Genomics

Comparative Map Data

Tex101
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,382,974 - 89,387,340 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	89,382,974 - 89,387,340 (-)	Ensembl				GRCr8
mRatBN7.2	1	80,255,076 - 80,259,442 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,255,076 - 80,259,442 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	85,646,992 - 85,651,359 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,198,491 - 94,202,857 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,402,749 - 87,407,116 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,529,776 - 81,534,149 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,529,781 - 81,534,140 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	82,787,105 - 82,791,476 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	79,946,338 - 79,949,053 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	74,707,230 - 74,709,945 (-)	NCBI		Celera
RGSC_v3.1	1	80,024,449 - 80,027,164 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

TEX101
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	43,388,611 - 43,418,597 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	43,401,496 - 43,418,597 (+)	Ensembl			hg38	GRCh38
GRCh37	19	43,892,763 - 43,922,749 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	48,584,603 - 48,614,589 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	48,584,602 - 48,614,588	NCBI
Celera	19	40,693,597 - 40,723,504 (+)	NCBI		Celera
Cytogenetic Map	19	q13.31	NCBI
HuRef	19	40,322,583 - 40,352,669 (+)	NCBI		HuRef
CHM1_1	19	43,894,311 - 43,924,421 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	46,209,044 - 46,238,972 (+)	NCBI		T2T-CHM13v2.0

Tex101
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	24,367,437 - 24,371,475 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	24,367,432 - 24,376,100 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	24,668,012 - 24,672,050 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	24,668,007 - 24,676,675 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	25,453,031 - 25,457,069 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	24,376,772 - 24,380,810 (-)	NCBI		MGSCv36	mm8
Celera	7	19,281,919 - 19,285,957 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	12.13	NCBI

Tex101
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	1,138,100 - 1,140,882 (+)	Ensembl
ChiLan1.0	NW_004955555	1,136,499 - 1,140,802 (+)	NCBI	ChiLan1.0	ChiLan1.0

TEX101
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	49,570,415 - 49,576,561 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	51,439,476 - 51,445,453 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	40,356,333 - 40,359,285 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	48,943,130 - 48,969,317 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	48,947,871 - 48,969,317 (+)	Ensembl			panPan2	panpan1.1

TEX101
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	111,683,964 - 111,687,115 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	111,683,961 - 111,687,179 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	111,163,495 - 111,166,646 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	112,293,938 - 112,297,089 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	112,294,110 - 112,296,308 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	111,882,014 - 111,885,165 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	111,515,794 - 111,518,945 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	112,400,228 - 112,403,378 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tex101
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	16,300,884 - 16,304,512 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936706	649,463 - 690,995 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TEX101
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	50,269,989 - 50,275,028 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	50,271,730 - 50,274,745 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	46,130,992 - 46,134,079 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TEX101
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	36,901,050 - 36,934,310 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666073	16,468,172 - 16,471,029 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tex101
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	979,778 - 981,959 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624907	978,395 - 983,659 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Tex101
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	165
Count of miRNA genes:	135
Interacting mature miRNAs:	147
Transcripts:	ENSRNOT00000027202
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat

Markers in Region

RH132043

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	80,255,228 - 80,255,415 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	81,529,929 - 81,530,115	NCBI	Rnor6.0
Rnor_5.0	1	82,787,258 - 82,787,444	UniSTS	Rnor5.0
RGSC_v3.4	1	79,946,486 - 79,946,672	UniSTS	RGSC3.4
Celera	1	74,707,378 - 74,707,564	UniSTS
RH 3.4 Map	1	823.5	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	4	14	79	53	57	37	48	37	159	73	10	69	37	83	20	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_139037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF347056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027202 ⟹ ENSRNOP00000027202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	89,382,974 - 89,387,340 (-)	Ensembl
mRatBN7.2 Ensembl	1	80,255,076 - 80,259,442 (-)	Ensembl
Rnor_6.0 Ensembl	1	81,529,781 - 81,534,140 (-)	Ensembl

RefSeq Acc Id:

NM_139037 ⟹ NP_620606

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	89,382,974 - 89,387,340 (-)	NCBI
mRatBN7.2	1	80,255,076 - 80,259,442 (-)	NCBI
Rnor_6.0	1	81,529,781 - 81,532,496 (-)	NCBI
Rnor_5.0	1	82,787,105 - 82,791,476 (-)	NCBI
RGSC_v3.4	1	79,946,338 - 79,949,053 (-)	RGD
Celera	1	74,707,230 - 74,709,945 (-)	RGD

Sequence:

show sequence

ATGGGAGCCTGCCGCATCCAGTACATCCTGCTCGTCTTTCTTCTGATAGCCTCGCATTGGACTC
TGGTCCAAAATATCTACTGTGAGGTGAGTCGAACCCTGAGTTTGGAAGACAATCCAAGCGGTAC
CTTTAACTGGACTTCAAAGGCTGAGAAGTGCAATCCTGGAGAATTTTGCCAAGAAACGGTACTG
TTGATTAAAGCAGAAGGAACCAAGACCGCCATTTTGGCCAGTAAGAGCTGTGTCCCTCAAGGAG
CAGAGACGATGACATTCGTTCAGTACACGGCCCCTCCTGGGCTGGTGGCCATTTCCTACAGTAA
CTACTGCAATGACTCCCTCTGCAACAACAGGAACAACTTAGCTTCAATCTTGCAAGCACCAGAG
CCCACAGCAACCTCCAACATGTCAGGAGCCCGCCACTGCCCAACATGCTTGGCCCTGGAGCCCT
GTTCCAGTGCCCCCTCTATGCCCTGTGCCAATGGCACAACTCAGTGCTACCACGGGAAGATCGA
GCTCTCTGGAGGAGGCATGGACTCCGTCGTGCATGTTAAAGGCTGCACCACTGCAATCGGCTGC
AGACTGATGGCCAAGATGGAGTCGGTGGGACCCATGACAGTGAAAGAGACCTGTAGTTACCAGT
CATTCCTTCACCCCCGAATGGCAGAGATCGGGGCCTCCTGGATGCCCACCTCACTGTGGGTGCT
GGAGCTCCTGCTTCCGGCGCTGTCGCTGCCCCTCATCTACTTCCCTTGAGAGGACACCGGGGGT
CAGGGGACGCCTTAGTCCCAGACACTGGGGGCCTTGGCTAGGAGGGAGCCTTCCGCTGCTGATA
CCAATCGGAAGGATTGGGGTGGGGTTGAACAAAAGGCTGCATGTGTATTGGACACGAATAATAA
AATTAGTGACTTGCTAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_620606	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK58911	(Get FASTA)	NCBI Sequence Viewer
	EDM08077	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027202
GenBank Protein	Q924B5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_620606 ⟸ NM_139037
- Peptide Label:	precursor
- UniProtKB:	Q924B5 (UniProtKB/Swiss-Prot), G3V8N9 (UniProtKB/TrEMBL), A6J907 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGACRIQYILLVFLLIASHWTLVQNIYCEVSRTLSLEDNPSGTFNWTSKAEKCNPGEFCQETVL LIKAEGTKTAILASKSCVPQGAETMTFVQYTAPPGLVAISYSNYCNDSLCNNRNNLASILQAPE PTATSNMSGARHCPTCLALEPCSSAPSMPCANGTTQCYHGKIELSGGGMDSVVHVKGCTTAIGC RLMAKMESVGPMTVKETCSYQSFLHPRMAEIGASWMPTSLWVLELLLPALSLPLIYFP hide sequence

Ensembl Acc Id:

ENSRNOP00000027202 ⟸ ENSRNOT00000027202

Protein Domains

UPAR/Ly6

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q924B5-F1-model_v2	AlphaFold	Q924B5	1-250	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689804

Promoter ID:

EPDNEW_R328

Type:

initiation region

Name:

Tex101_1

Description:

testis expressed 101

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	81,534,130 - 81,534,190	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621373	AgrOrtholog
BioCyc Gene	G2FUF-60433	BioCyc
Ensembl Genes	ENSRNOG00000020057	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000027202	ENTREZGENE
InterPro	Fert-Immune_med_protein	UniProtKB/Swiss-Prot
	LY6_UPA_recep-like	UniProtKB/Swiss-Prot
KEGG Report	rno:207113	UniProtKB/Swiss-Prot
NCBI Gene	207113	ENTREZGENE
PANTHER	CD177 ANTIGEN	UniProtKB/Swiss-Prot
	CD177 ANTIGEN	UniProtKB/Swiss-Prot
Pfam	UPAR_LY6	UniProtKB/Swiss-Prot
PhenoGen	Tex101	PhenoGen
RatGTEx	ENSRNOG00000020057	RatGTEx
UniProt	A6J907	ENTREZGENE, UniProtKB/TrEMBL
	G3V8N9	ENTREZGENE, UniProtKB/TrEMBL
	Q924B5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Tex101	testis expressed 101	LOC100911185	testis-expressed sequence 101 protein-like	Data merged from RGD:6494867	737654	PROVISIONAL
2012-07-05	LOC100911185	testis-expressed sequence 101 protein-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-09-24	Tex101	testis expressed 101	Tex101	testis expressed gene 101	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Tex101	testis expressed gene 101	Tec21	lipid raft-associated glycoprotein TEC-21	Symbol and Name updated	1299863	APPROVED
2002-08-07	Tec21	lipid raft-associated glycoprotein TEC-21			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to lipid rafts on plasma membrane	634491
gene_protein	glycosylphosphatidylinositol-anchored plasma membrane glycoprotein	634491

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar