Epcam (epithelial cell adhesion molecule)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Epcam (epithelial cell adhesion molecule) Rattus norvegicus

Analyze

Symbol:

Epcam

Name:

epithelial cell adhesion molecule

RGD ID:

621365

Description:

Enables cadherin binding activity involved in cell-cell adhesion. Involved in cell-cell adhesion via plasma-membrane adhesion molecules; negative regulation of apoptotic process; and positive regulation of cell motility. Located in bicellular tight junction; cell surface; and lateral plasma membrane. Biomarker of middle cerebral artery infarction. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 1-nitropropane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Egp314; ep-CAM; epithelial glycoprotein 314; Tacstd1; tumor-associated calcium signal transducer 1

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	6,880,142 - 6,896,103 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	6,878,237 - 6,896,127 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	7,162,229 - 7,178,185 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	7,471,633 - 7,487,591 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	6,998,763 - 7,014,715 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	11,282,194 - 11,308,870 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	11,281,964 - 11,298,216 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	21,264,116 - 21,280,078 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	11,176,664 - 11,192,628 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	11,176,663 - 11,192,627 (+)	NCBI
Celera	6	6,637,498 - 6,653,429 (-)	NCBI		Celera
Cytogenetic Map	6	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

colon carcinoma (ISO)

Colonic Neoplasms (ISO)

congenital diarrhea 5 with tufting enteropathy (ISO,ISS)

Experimental Liver Cirrhosis (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

hereditary breast ovarian cancer syndrome (ISO)

Hereditary Neoplastic Syndromes (ISO)

hereditary nonpolyposis colorectal cancer type 8 (ISO)

Lynch syndrome (ISO)

Lynch syndrome 1 (ISO)

middle cerebral artery infarction (IEP)

Neoplasm Metastasis (IMP)

ovarian cancer (ISO)

Ovarian Neoplasms (ISO)

pancreatic cancer (ISO)

Prostatic Neoplasms (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(20S)-ginsenoside Rg3 (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropropane (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-diaminotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-diaminotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (EXP)

2-nitro-p-phenylenediamine (EXP)

2-nitropropane (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO)

3-Nitrobenzanthrone (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-acetylaminofluorene (EXP)

4-hydroxyphenyl retinamide (ISO)

4-nitro-1,2-phenylenediamine (EXP)

4-nitroquinoline N-oxide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-hexachlorocyclohexane (EXP)

amiodarone (EXP)

ammonium chloride (EXP)

ampicillin (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

belinostat (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carboplatin (ISO)

casticin (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crizotinib (ISO)

cumene (ISO)

curcumin (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

eugenol (ISO)

flavonol (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glycidol (EXP)

GW 3965 (ISO)

indole-3-methanol (EXP)

inulin (ISO)

iron dichloride (ISO)

L-ethionine (EXP)

L-methionine (ISO)

lead(0) (ISO)

lidocaine (EXP)

mercury dibromide (ISO)

methamphetamine (EXP)

methylmercury chloride (ISO)

metronidazole (EXP)

microcystin-LR (EXP)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (EXP)

neomycin (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

omeprazole (EXP)

p-chloromercuribenzoic acid (ISO)

p-toluidine (EXP)

paclitaxel (ISO)

panobinostat (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

phenylmercury acetate (ISO)

pirinixic acid (EXP)

potassium chromate (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

raloxifene (ISO)

resveratrol (EXP)

rotenone (EXP)

SB 431542 (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

streptozocin (EXP)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

topotecan (ISO)

tributylstannane (ISO)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

valproic acid (ISO)

vancomycin (EXP)

vincaleukoblastine (ISO)

vinclozolin (EXP)

vinorelbine (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell-cell adhesion via plasma-membrane adhesion molecules (IDA)

negative regulation of apoptotic process (IDA)

negative regulation of cell-cell adhesion mediated by cadherin (IEA,ISO)

positive regulation of cell motility (IDA)

positive regulation of cell population proliferation (ISO,ISS)

positive regulation of stem cell proliferation (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

signal transduction involved in regulation of gene expression (IEA,ISO)

stem cell differentiation (IEA,ISO)

ureteric bud development (IEA,ISO)

Cellular Component

apical plasma membrane (IEA,ISO)

basolateral plasma membrane (IEA,ISO)

bicellular tight junction (IBA,IDA,IEA,ISO)

cell surface (IDA,IEA,ISO)

lateral plasma membrane (IDA,IEA,ISO)

plasma membrane (ISO)

Molecular Function

cadherin binding involved in cell-cell adhesion (IBA,IPI)

protein binding (ISO)

protein-containing complex binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Cancer stem cell markers correlate with early recurrence and survival in hepatocellular carcinoma.	Guo Z, etal., World J Gastroenterol. 2014 Feb 28;20(8):2098-106. doi: 10.3748/wjg.v20.i8.2098.
3.	The cell-cell adhesion molecule EpCAM interacts directly with the tight junction protein claudin-7.	Ladwein M, etal., Exp Cell Res. 2005 Oct 1;309(2):345-57.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Claudin-7 regulates EpCAM-mediated functions in tumor progression.	Nubel T, etal., Mol Cancer Res. 2009 Mar;7(3):285-99. doi: 10.1158/1541-7786.MCR-08-0200. Epub 2009 Mar 10.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	EGP-314 is expressed differentially in three brain zones at an early time in an experimentally induced ischemia rat model.	Ortiz-Plata A, etal., Brain Res Mol Brain Res. 2005 Jun 13;137(1-2):55-62. Epub 2005 Apr 7.
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	EpCAM-associated claudin-7 supports lymphatic spread and drug resistance in rat pancreatic cancer.	Thuma F and Zoller M, Int J Cancer. 2013 Aug 15;133(4):855-66. doi: 10.1002/ijc.28085. Epub 2013 Mar 9.
13.	Metastasis-association of the rat ortholog of the human epithelial glycoprotein antigen EGP314.	Wurfel J, etal., Oncogene 1999 Apr 8;18(14):2323-34.

Additional References at PubMed

PMID:9382878	PMID:11487543	PMID:15195135	PMID:15922867	PMID:16545622	PMID:17599412	PMID:18025791	PMID:19056867	PMID:19136966	PMID:19785009	PMID:23098445	PMID:23376485
PMID:25367431

Genomics

Comparative Map Data

Epcam
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	6,880,142 - 6,896,103 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	6,878,237 - 6,896,127 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	7,162,229 - 7,178,185 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	7,471,633 - 7,487,591 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	6,998,763 - 7,014,715 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	11,282,194 - 11,308,870 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	11,281,964 - 11,298,216 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	21,264,116 - 21,280,078 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	11,176,664 - 11,192,628 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	11,176,663 - 11,192,627 (+)	NCBI
Celera	6	6,637,498 - 6,653,429 (-)	NCBI		Celera
Cytogenetic Map	6	q12	NCBI

EPCAM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	47,369,311 - 47,387,020 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	47,345,158 - 47,387,601 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	47,596,450 - 47,614,159 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	47,449,971 - 47,467,661 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	47,508,117 - 47,525,808	NCBI
Celera	2	47,435,038 - 47,452,920 (+)	NCBI		Celera
Cytogenetic Map	2	p21	NCBI
HuRef	2	47,332,819 - 47,350,813 (+)	NCBI		HuRef
CHM1_1	2	47,526,380 - 47,544,227 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	47,374,345 - 47,392,054 (+)	NCBI		T2T-CHM13v2.0

Epcam
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	87,943,407 - 87,958,555 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	87,943,407 - 87,958,557 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	87,635,979 - 87,651,127 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	87,635,979 - 87,651,129 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	88,035,319 - 88,050,467 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	87,545,034 - 87,559,453 (+)	NCBI		MGSCv36	mm8
Celera	17	92,042,942 - 92,058,080 (+)	NCBI		Celera
Cytogenetic Map	17	E4	NCBI
cM Map	17	57.87	NCBI

Epcam
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955441	14,155,082 - 14,169,161 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955441	14,155,084 - 14,167,584 (+)	NCBI	ChiLan1.0	ChiLan1.0

EPCAM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	79,001,229 - 79,018,984 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	47,490,748 - 47,508,418 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	48,414,791 - 48,432,038 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	48,413,520 - 48,432,038 (+)	Ensembl	panpan1.1		panPan2

EPCAM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	49,446,165 - 49,498,690 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	49,485,746 - 49,498,475 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	49,340,952 - 49,353,876 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	50,358,759 - 50,372,148 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	50,357,906 - 50,373,405 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	50,066,503 - 50,079,814 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	50,354,644 - 50,367,879 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	50,540,181 - 50,553,474 (+)	NCBI		UU_Cfam_GSD_1.0

Epcam
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	33,590,900 - 33,604,003 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936508	5,019,918 - 5,032,414 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936508	5,019,513 - 5,032,610 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EPCAM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	93,168,852 - 93,185,653 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	93,169,800 - 93,185,221 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	99,312,713 - 99,328,225 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EPCAM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	59,815,128 - 59,832,360 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	59,815,064 - 59,832,229 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	52,016,345 - 52,034,127 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Epcam
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	28,754,602 - 28,770,758 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	28,755,039 - 28,770,160 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Epcam
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	283
Count of miRNA genes:	201
Interacting mature miRNAs:	225
Transcripts:	ENSRNOT00000021135
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293706	Bmd20	Bone mineral density QTL 20	4.3	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	5074497	19988050	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat

Markers in Region

D6Wox32

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	6,880,190 - 6,880,356 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	11,282,243 - 11,282,408	NCBI	Rnor6.0
Rnor_5.0	6	21,264,165 - 21,264,330	UniSTS	Rnor5.0
RGSC_v3.4	6	11,192,414 - 11,192,579	UniSTS	RGSC3.4
Celera	6	6,637,547 - 6,637,712	UniSTS
Cytogenetic Map	6	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	2
Medium	1	2	23	15	8	15			8	35	40	11
Low		5	34	26	11	26	6	7	62		1		6
Below cutoff		33					2	4	4				2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ001044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021135 ⟹ ENSRNOP00000021135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	6,880,143 - 6,896,107 (-)	Ensembl
Rnor_6.0 Ensembl	6	11,281,964 - 11,298,216 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095257 ⟹ ENSRNOP00000078936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	6,885,259 - 6,893,492 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109202 ⟹ ENSRNOP00000077664

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	6,878,237 - 6,896,127 (-)	Ensembl

RefSeq Acc Id:

NM_138541 ⟹ NP_612550

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	6,880,142 - 6,896,103 (-)	NCBI
Rnor_6.0	6	11,282,194 - 11,298,156 (-)	NCBI
Rnor_5.0	6	21,264,116 - 21,280,078 (-)	NCBI
RGSC_v3.4	6	11,176,664 - 11,192,628 (+)	RGD
Celera	6	6,637,498 - 6,653,429 (-)	RGD

Sequence:

show sequence

CAGCGCGACTGTCCCTGGAGCCGTCCCGCGCCTCAGACCCGCGAGTCCCCGCCGCTCCGCGCGC
AGTATGGCGCCCCCCAAGGCCCTCGCGTTCGGGCTCCTGCTCGCGGTGGTCACGGCGACGCTGG
CCGCAGCTCAGAAAGACTGTGTCTGTAACAACTACAAGCTGACGTCACGGTGCTATGAGAATGA
GAATGGTGAATGCCAGTGTACTTCCTATGGGACACAAAATACTGTCATTTGCTCCAAACTGGCA
TCCAAGTGCTTGGTGATGAAGGCGGAGATGACTCACAGCAAGTCTGGGAGGAGGATGAAACCCG
AGGGGGCGATCCAGAACAACGACGGTCTGTATGATCCCGAGTGTGACGAGCAAGGGCTCTTCAA
AGCCAAGCAGTGCAACGGCACCGCCACGTGCTGGTGCGTGAACACCGCGGGTGTCCGGAGAACC
GACAAGGACACGGAGATCACGTGCTCCGAGAGAGTGAGGACCTACTGGATCATCATTGAGCTCA
AACACAAAGAAAGAGCACAGCCTTATAACTTCGAGAGTTTGCATACTGCACTTCAGGACACATT
TGCATCTCGATACATGCTGAATCCGAAATTTATCAAAAGTATTATGTATGAGAATAATGTTATC
ACTATTGATTTGATGCAAAACTCTTCTCAGAAGACTCAAGATGATGTGGACATAGCTGATGTGG
CTTACTATTTTGAGAAAGATGTAAAGGGGGAGTCCTTGTTCCATTCATCTAAGAGCATGGACCT
GAGGGTGAACGGGGAGCTCCTCGATCTGGACCCCGGGCAGACTCTGATTTACTACGTCGATGAA
AAGGCCCCGGAGTTTTCCATGCAGGGCCTCACGGCTGGGATCATCGCCGTCATTGTCGTGGTGG
TGTTAGCAGTCATTGCGGGGATTGTTGTCCTGGTTATATCTACAAGGAAGAGATCAGCAAAATA
TGAGAAGGCTGAGATAAAGGAGATGGGTGAGATACACAGAGAGCTCAATGCCTAACCAACCATG
CCGTGTGCTGCACTGAGGAGGGAGCCACCGGACGGAAATGGCGAAGAACTCAGGTTGCAAACGG
ATAGACCTGGGGAGGATGGAGACCTTTCGAGGGTCACTGCTTTGTTAGCTAAGCTCACACATTT
GTAACAGTGAAATTTGTACTCATAAATACAAGCAGCTTGACATTGGCATTAACAATCTTAAAAT
TAGACGAGTGTCTTACACATGCAGGTCTGGCGTGGAACTCAGAACTTAGCCTGCCAAGATAGGA
GAGCTTATGCTTATTGTTGAAGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCATAAAC
AGCCCACAGTAGAATACGATGACTACTCTCATTTTTGTGATTAAAGCTGCCCTTCTACACACTG
AGTCTTGTACATAATAAACGTTTTTAATGAAATAAAACATTTTTAAACTGAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_612550	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH72691	(Get FASTA)	NCBI Sequence Viewer
	CAA04498	(Get FASTA)	NCBI Sequence Viewer
	EDM02636	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021135
	ENSRNOP00000077664.1
	ENSRNOP00000078936.1
GenBank Protein	O55159	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_612550 ⟸ NM_138541
- Peptide Label:	precursor
- UniProtKB:	O55159 (UniProtKB/Swiss-Prot), A0A8I5YCG2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPPKALAFGLLLAVVTATLAAAQKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLAS KCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTD KDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVIT IDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEK APEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA hide sequence

RefSeq Acc Id:

ENSRNOP00000021135 ⟸ ENSRNOT00000021135

RefSeq Acc Id:

ENSRNOP00000077664 ⟸ ENSRNOT00000109202

RefSeq Acc Id:

ENSRNOP00000078936 ⟸ ENSRNOT00000095257

Protein Domains

Thyroglobulin type-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O55159-F1-model_v2	AlphaFold	O55159	1-315	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694396

Promoter ID:

EPDNEW_R4921

Type:

multiple initiation site

Name:

Epcam_1

Description:

epithelial cell adhesion molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	11,298,174 - 11,298,234	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621365	AgrOrtholog
BioCyc Gene	G2FUF-38744	BioCyc
Ensembl Genes	ENSRNOG00000015667	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021135	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000095257.1	UniProtKB/TrEMBL
	ENSRNOT00000109202.1	UniProtKB/TrEMBL
Gene3D-CATH	4.10.800.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5623760	IMAGE-MGC_LOAD
	IMAGE:7098920	IMAGE-MGC_LOAD
InterPro	EPCAM/Trop-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EpCAM_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thyroglobulin_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thyroglobulin_1_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171577	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72276	IMAGE-MGC_LOAD
	MGC:91434	IMAGE-MGC_LOAD
NCBI Gene	171577	ENTREZGENE
PANTHER	EPITHELIAL CELL ADHESION MOLECULE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14168	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	EpCAM_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thyroglobulin_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Epcam	PhenoGen
PROSITE	THYROGLOBULIN_1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	THYROGLOBULIN_1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015667	RatGTEx
SMART	SM00211	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF57610	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5YCG2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZMC1_RAT	UniProtKB/TrEMBL
	EPCAM_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-03-13	Epcam	epithelial cell adhesion molecule	Tacstd1	tumor-associated calcium signal transducer 1	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2004-09-10	Tacstd1	tumor-associated calcium signal transducer 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Tacstd1	tumor-associated calcium signal transducer 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the epithelial cells of metastasizing rat tumors	634200

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM