Advanced Search (OLGA)

Gene: Gpc2 (glypican 2) Rattus norvegicus

Analyze

Symbol:

Gpc2

Name:

glypican 2

RGD ID:

621363

Description:

Involved in neuron differentiation; positive regulation of neuron projection development; and smoothened signaling pathway. Predicted to be located in endoplasmic reticulum. Predicted to be active in cell surface and synapse. Orthologous to human GPC2 (glypican 2); PARTICIPATES IN Hedgehog signaling pathway; glypican signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cerebroglycan; glypican 2 (cerebroglycan); glypican-2; HSPG M13

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPC2 (glypican 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gpc2 (glypican 2 cerebroglycan)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpc2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPC2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPC2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpc2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPC2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPC2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpc2 (glypican 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CCL25 (C-C motif chemokine ligand 25)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GPC2 (glypican 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpc2 (glypican 2 cerebroglycan)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpc2 (glypican 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gpc2 (glypican 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	gpn-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpn-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dlp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dlp	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpc2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,391,489 - 22,397,822 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	22,391,489 - 22,397,822 (-)	Ensembl				GRCr8
mRatBN7.2	12	17,277,875 - 17,284,297 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	17,277,875 - 17,284,208 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	18,244,924 - 18,251,250 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	18,868,646 - 18,874,972 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	17,922,063 - 17,928,389 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	19,593,041 - 19,599,374 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,593,041 - 19,599,374 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	21,649,636 - 21,655,969 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	17,858,354 - 17,864,687 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	19,202,336 - 19,208,665 (-)	NCBI		Celera
RGSC_v3.1	12	17,847,875 - 17,854,209 (-)	NCBI
Cytogenetic Map	12	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP,ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

Cuprizon (EXP)

dexamethasone (ISO)

dorsomorphin (ISO)

exemestane (ISO)

folic acid (ISO)

glycidol (EXP)

monosodium L-glutamate (EXP)

niclosamide (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (EXP,ISO)

pentanal (ISO)

phenylmercury acetate (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell migration (IBA)

neuron differentiation (IDA)

positive regulation of neuron projection development (IDA)

regulation of protein localization to membrane (IBA)

regulation of signal transduction (IEA)

smoothened signaling pathway (IBA,IMP)

Cellular Component

cell surface (IBA)

endoplasmic reticulum (IEA,ISO)

extracellular region (IEA)

membrane (IEA)

plasma membrane (IEA)

side of membrane (IEA)

synapse (IBA)

Molecular Function

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glypican signaling pathway (ISO)

Hedgehog signaling pathway (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Glypican-2 binds to midkine: the role of glypican-2 in neuronal cell adhesion and neurite outgrowth.	Kurosawa N, etal., Glycoconj J. 2001 Jun;18(6):499-507.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	HB-GAM (pleiotrophin) reverses inhibition of neural regeneration by the CNS extracellular matrix.	Paveliev M, etal., Sci Rep. 2016 Sep 27;6:33916. doi: 10.1038/srep33916.
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Cerebroglycan: an integral membrane heparan sulfate proteoglycan that is unique to the developing nervous system and expressed specifically during neuronal differentiation.	Stipp CS, etal., J Cell Biol 1994 Jan;124(1-2):149-60.
11.	Dally-like core protein and its mammalian homologues mediate stimulatory and inhibitory effects on Hedgehog signal response.	Williams EH, etal., Proc Natl Acad Sci U S A. 2010 Mar 30;107(13):5869-74. Epub 2010 Mar 15.

Genomics

Comparative Map Data

Gpc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,391,489 - 22,397,822 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	22,391,489 - 22,397,822 (-)	Ensembl				GRCr8
mRatBN7.2	12	17,277,875 - 17,284,297 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	17,277,875 - 17,284,208 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	18,244,924 - 18,251,250 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	18,868,646 - 18,874,972 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	17,922,063 - 17,928,389 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	19,593,041 - 19,599,374 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,593,041 - 19,599,374 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	21,649,636 - 21,655,969 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	17,858,354 - 17,864,687 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	19,202,336 - 19,208,665 (-)	NCBI		Celera
RGSC_v3.1	12	17,847,875 - 17,854,209 (-)	NCBI
Cytogenetic Map	12	q11	NCBI

GPC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	100,169,606 - 100,177,381 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	100,169,606 - 100,177,381 (-)	Ensembl			hg38	GRCh38
GRCh37	7	99,767,229 - 99,775,004 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	99,605,165 - 99,612,926 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	99,411,879 - 99,419,641	NCBI
Celera	7	94,502,575 - 94,510,340 (-)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	94,402,023 - 94,409,735 (-)	NCBI		HuRef
CHM1_1	7	99,697,303 - 99,705,068 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	101,409,400 - 101,417,191 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	99,127,317 - 99,135,078 (-)	NCBI

Gpc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	138,271,918 - 138,278,288 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	138,271,917 - 138,278,267 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	138,273,657 - 138,280,026 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	138,273,655 - 138,280,005 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	138,714,888 - 138,721,165 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	138,503,448 - 138,509,725 (-)	NCBI		MGSCv36	mm8
Celera	5	135,256,511 - 135,262,788 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	77.0	NCBI

Gpc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955573	630,859 - 637,296 (+)	Ensembl
ChiLan1.0	NW_004955573	630,859 - 637,296 (+)	NCBI	ChiLan1.0	ChiLan1.0

GPC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	118,088,532 - 118,096,221 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	166,353,164 - 166,363,059 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	92,204,355 - 92,213,750 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	105,637,059 - 105,645,115 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	105,637,682 - 105,644,888 (-)	Ensembl			panPan2	panpan1.1

GPC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	9,354,181 - 9,361,361 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	9,354,535 - 9,361,375 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	11,057,530 - 11,065,347 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	9,287,230 - 9,295,035 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	9,288,223 - 9,295,049 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	9,139,687 - 9,147,491 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	9,118,759 - 9,126,553 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	9,299,810 - 9,307,638 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gpc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	133,606,525 - 133,612,846 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	424,319 - 429,903 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	424,244 - 429,903 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	8,169,343 - 8,175,580 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	8,169,229 - 8,175,848 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	7,346,211 - 7,352,851 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	12,892,092 - 12,899,288 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	12,892,057 - 12,898,657 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	3,381,153 - 3,388,396 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	16,734,526 - 16,740,841 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	16,734,407 - 16,740,845 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Gpc2
47 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	433
Count of miRNA genes:	228
Interacting mature miRNAs:	269
Transcripts:	ENSRNOT00000001849
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	20139028	26430640	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	87	59	6	349	187	11	139	79	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L20468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001849 ⟹ ENSRNOP00000001849

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,391,489 - 22,397,822 (-)	Ensembl
mRatBN7.2 Ensembl	12	17,277,875 - 17,284,208 (-)	Ensembl
Rnor_6.0 Ensembl	12	19,593,041 - 19,599,374 (-)	Ensembl

RefSeq Acc Id:

NM_138511 ⟹ NP_612520

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,391,489 - 22,397,822 (-)	NCBI
mRatBN7.2	12	17,277,875 - 17,284,208 (-)	NCBI
Rnor_6.0	12	19,593,041 - 19,599,374 (-)	NCBI
Rnor_5.0	12	21,649,636 - 21,655,969 (-)	NCBI
RGSC_v3.4	12	17,858,354 - 17,864,687 (-)	RGD
Celera	12	19,202,336 - 19,208,665 (-)	RGD

Sequence:

show sequence

GATCATTGGCGGGCTCCAGCTTCGGGTCCCGCCCCCTGTCCCGCTCCCCGGCTCCCATTGTCTC
CGCAGATGCCTCCTAGTCCAGCTACCGTGCTGGGGCTGTTCAGTTTTGGGGGGGACGCTCGTAT
TCTTTTCTTCGAGACGTCCCGCGGCCGAGAACAGGATTTTAGAGTTCCGTGGACTCTTTTTTCC
TCCTTAGGACTCACTTTGCCCCGTCCCAGGAAGGAGAGCAGCTATGTCCGCGGTGCGACCTCTC
CTGCTTTTGCTGCTCCCTCTGTGTCCCGGTCCAGGACCGGGACATGGGAGTGAAGCAAAGGTCG
TCCGGAGTTGTGCAGAGACTCGGCAGGTGCTGGGGGCCCGGGGATATAGCTTAAACCTTATCCC
TCCCTCCCTCATCTCAGGTGAGCACCTTCAGATCTGTCCTCAGGAGTACACCTGCTGTTCCAGT
GAGACAGAGCAGAAGTTGATCCGGGATGCTGAGGTCACCTTCCGTGGCCTGGTGGAAGACAGTG
GCTCCTTCCTGATTCACACGCTGGCTGCCCGCCACAGAAAGTTTAACGAGTTTTTTCGGGAGAT
GCTGTCTATATCCCAGCATTCTTTGGCCCAGCTCTTCTCGCATTCCTATGGTCGCCTGTATTCC
CAGCATGCCGTCATCTTCAATAGCCTGTTCTCCGGCCTGCGGGACTACTATGAGAAGTCTGGTG
AGGGGTTAGATGACACCTTGGCAGACTTCTGGGCCCAGCTCCTGGAGAGAGCCTTCCCTTTGCT
GCACCCACAATACAGTTTCCCTCCTGATTTCCTGCTCTGCCTTACTCGGCTCACTTCAACTGCT
GATGGCTCTCTCCAGCCCTTCGGGGACTCGCCCCGCCGCCTCCGCCTACAGATAACCCGGGCAC
TGGTGGCAGCCCGGGCCTTGGTCCAGGGTCTGGAGACCGGAAGAAATGTGGTCAGCGAAGCACT
TAAGGTACCCATGTTGGAAGGCTGCAGACAGGCCCTCATGCGTCTGATCGGCTGCCCACTTTGT
CGGGGAGTACCCTCGCTTATGCCCTGCCGGGGCTTCTGCCTCAATGTGGCCCACGGCTGTCTCA
GCAGCAGGGGATTGGAGCCTGAATGGGGCGGATATCTGGATGGTCTCCTGCTGCTGGCTGAGAA
ACTCCAGGGACCCTTTTCCTTCGAGCTGGCTGCTGAGTCCATAGGGGTGAAGATCTCAGAAGGT
TTGATGCACTTGCAGGAAAACAGTGTAAAGGTGTCAGCCAAGGTGTTTCAGGAATGTGGGACGC
CTCACCCGGTGCAATCCCGTAACCGGCGAGCACCAGCACCCCGGGAAGAGACTAGCCGGTCTTG
GAGGTCGTCAGCTGAGGAAGAACGCCCCACAACAGCGGCAGGCACTAATCTGCACCGTCTGGTT
TGGGAGCTCCGAGAGAGGCTTAGCCGAGTGCGGGGCTTCTGGGCTGGACTTCCCGTTACGGTGT
GTGGGGACTCCCGCATGGCGGCAGATCTCTCCCAGGAGGCGGCACCCTGCTGGACTGGGGTTGG
GAGAGGCCGGTATATGTCGCCTGTGGTCGTGGGCTCCTTGAACGAGCAGCTCCATAACCCGGAG
TTGGATACTTCGAGTCCCGATGTCCCGACACGTCGGCGGAGGCTCCATCTCCGAGCAGCTACTG
CTCGAATGAAGGCGGCTGCGCTGGGCCAGGACCTTGACATGCATGATGCGGATGAAGACGCCAG
TGGCTCCGGAGGGGGACAGCAGTACGCAGACGACTGGAAAGCTGGGGCAGCGCCTGTGGTTCCC
CCAGCCAGGCCTCCAAGGCCACCTCGTCCTCCTCGAAGGGATGGTCTTGGAGTGAGAGGAGGAA
GTGGCAGTGCCAGATACAACCAGGGCCGAAGCAGGAATCTGGGGTCCTCTGTTGGCCTCCATGC
CCCACGTGTCTTCATTCTCCTCCCCTCAGCCCTGACCCTGCTTGGACTTCGATAACAAGCGAGG
GGCGCCCTAGCGTCAGGAGGCTTAGTGGCCTTTTCCTTCCACCTCCCTCAGCTGGGCATGAGGA
AGAATGGAAGGGGGCTACCGGGAGGGCAGAAAGGGACTTTGTAGGTAAATGGCTGGGGCCCCAA
ATCCAGGAGTTTCCTATTAGTGGGTTGGGAGGGGAGGTAGATGGGTGTTCATAATATTTATTTT
TTCATTTGGGAACTGGGGATATTTATTTAGGAAGGGATTGTGGTTCAGCTCTTTTAAGGCTTGG
GTCTCATTGATGCAAAAGGCAGGGGGTGGGGTTGGGATCGGGTTGAAGGAACTTGGAAGTGGGG
AGGGGTGGCACTATTGGCATGGGGGTACCTGATATTGAAAATGAACAAATAAACTAGCTGAGAG
TGATGTCACTTGCCTGTAAACCATTATTTTGGAGGCTGAGGCAGGAGGATTGAGCGTTGGAGAC
CCATAAAATTAGGTGCTGATAGTGGAACAGGCGGGGTGGGAGGTAGGACCTGAGTTTTATTGAC
TTTTAAAATCATCTGTTTCTTAAATATGGGGGAACCCATCTTGTGACCTTTGCTGTCTAATGTT
TCAGTGTTCACATCGGTGTTTATTGGTAAATAAACAATTTGACCATG

hide sequence

RefSeq Acc Id:

XM_039089051 ⟹ XP_038944979

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,392,246 - 22,397,796 (-)	NCBI
mRatBN7.2	12	17,278,637 - 17,284,297 (-)	NCBI

RefSeq Acc Id:

XM_039089052 ⟹ XP_038944980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,391,489 - 22,396,739 (-)	NCBI
mRatBN7.2	12	17,277,875 - 17,283,123 (-)	NCBI

RefSeq Acc Id:

XM_039089053 ⟹ XP_038944981

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,391,489 - 22,396,741 (-)	NCBI
mRatBN7.2	12	17,277,875 - 17,283,116 (-)	NCBI

RefSeq Acc Id:

XM_039089054 ⟹ XP_038944982

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,391,489 - 22,395,015 (-)	NCBI
mRatBN7.2	12	17,277,875 - 17,281,414 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_612520	(Get FASTA)	NCBI Sequence Viewer
	XP_038944979	(Get FASTA)	NCBI Sequence Viewer
	XP_038944980	(Get FASTA)	NCBI Sequence Viewer
	XP_038944981	(Get FASTA)	NCBI Sequence Viewer
	XP_038944982	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40961	(Get FASTA)	NCBI Sequence Viewer
	EDL83911	(Get FASTA)	NCBI Sequence Viewer
	EDL83912	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001849
	ENSRNOP00000001849.2
GenBank Protein	P51653	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_612520 ⟸ NM_138511
- Peptide Label:	precursor
- UniProtKB:	P51653 (UniProtKB/Swiss-Prot), A6KSU6 (UniProtKB/TrEMBL), A6KSU5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAVRPLLLLLLPLCPGPGPGHGSEAKVVRSCAETRQVLGARGYSLNLIPPSLISGEHLQICPQ EYTCCSSETEQKLIRDAEVTFRGLVEDSGSFLIHTLAARHRKFNEFFREMLSISQHSLAQLFSH SYGRLYSQHAVIFNSLFSGLRDYYEKSGEGLDDTLADFWAQLLERAFPLLHPQYSFPPDFLLCL TRLTSTADGSLQPFGDSPRRLRLQITRALVAARALVQGLETGRNVVSEALKVPMLEGCRQALMR LIGCPLCRGVPSLMPCRGFCLNVAHGCLSSRGLEPEWGGYLDGLLLLAEKLQGPFSFELAAESI GVKISEGLMHLQENSVKVSAKVFQECGTPHPVQSRNRRAPAPREETSRSWRSSAEEERPTTAAG TNLHRLVWELRERLSRVRGFWAGLPVTVCGDSRMAADLSQEAAPCWTGVGRGRYMSPVVVGSLN EQLHNPELDTSSPDVPTRRRRLHLRAATARMKAAALGQDLDMHDADEDASGSGGGQQYADDWKA GAAPVVPPARPPRPPRPPRRDGLGVRGGSGSARYNQGRSRNLGSSVGLHAPRVFILLPSALTLL GLR hide sequence

Ensembl Acc Id:

ENSRNOP00000001849 ⟸ ENSRNOT00000001849

RefSeq Acc Id:	XP_038944980 ⟸ XM_039089052
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038944981 ⟸ XM_039089053
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038944982 ⟸ XM_039089054
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038944979 ⟸ XM_039089051
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51653-F1-model_v2	AlphaFold	P51653	1-579	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621363	AgrOrtholog
BioCyc Gene	G2FUF-19774	BioCyc
Ensembl Genes	ENSRNOG00000001367	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001849	ENTREZGENE
	ENSRNOT00000001849.5	UniProtKB/Swiss-Prot
InterPro	Glypican	UniProtKB/Swiss-Prot
	Glypican_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:171517	UniProtKB/Swiss-Prot
NCBI Gene	171517	ENTREZGENE
PANTHER	PTHR10822	UniProtKB/Swiss-Prot
	PTHR10822:SF24	UniProtKB/Swiss-Prot
Pfam	Glypican	UniProtKB/Swiss-Prot
PhenoGen	Gpc2	PhenoGen
PROSITE	GLYPICAN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001367	RatGTEx
UniProt	A6KSU5	ENTREZGENE, UniProtKB/TrEMBL
	A6KSU6	ENTREZGENE, UniProtKB/TrEMBL
	GPC2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-26	Gpc2	glypican 2	Gpc2	glypican 2 (cerebroglycan)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Gpc2	glypican 2 (cerebroglycan)		cerebroglycan	Name updated	1299863	APPROVED
2002-08-07	Gpc2	cerebroglycan			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	has five potential heparan sulfite attachment sites
gene_expression	expressed only in nerve tissue	728608
gene_expression	mRNA expressed in immature neurons, disappearing after completion of cell migration and axon outgrowth	728608
gene_product	member of integral membrane heparan sulfate proteoglycans (HSPGs), characterized by glycosylphosphatidylinositol (GPI) linkage and conserved structural motifs	728608
gene_protein	protein has predicted mass of 58.6 kDa	728608

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)