Hes5 (hes family bHLH transcription factor 5)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hes5 (hes family bHLH transcription factor 5) Rattus norvegicus

Analyze

Symbol:

Hes5

Name:

hes family bHLH transcription factor 5

RGD ID:

621340

Description:

Enables chromatin binding activity and double-stranded DNA binding activity. Involved in several processes, including generation of neurons; negative regulation of cell differentiation; and neuronal stem cell population maintenance. Acts upstream of or within negative regulation of transcription by RNA polymerase II. Biomarker of diabetes mellitus. Orthologous to human HES5 (hes family bHLH transcription factor 5); PARTICIPATES IN Notch signaling pathway; Notch signaling pathway; INTERACTS WITH 2,2',4,4',5,5'-hexachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hairy and enhancer of split 5; hairy and enhancer of split 5 (Drosophila); transcription factor HES-5

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	165,522,138 - 165,523,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	165,522,234 - 165,523,001 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	168,227,682 - 168,228,449 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	170,049,096 - 170,049,863 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	170,011,628 - 170,012,395 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	172,364,421 - 172,365,188 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	172,364,421 - 172,365,188 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	175,820,392 - 175,821,159 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	171,763,869 - 171,764,636 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	171,774,363 - 171,775,131 (+)	NCBI
Celera	5	163,728,713 - 163,729,480 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Neoplasms (ISO)

chromosome 1p36 deletion syndrome (ISO)

diabetes mellitus (IEP)

dilated cardiomyopathy 1LL (ISO)

Ehlers-Danlos syndrome spondylodysplastic type 2 (ISO)

genetic disease (ISO)

Goldberg-Shprintzen syndrome (ISO)

immunodeficiency 16 (ISO)

immunodeficiency 38 (ISO)

Joubert syndrome 25 (ISO)

nervous system disease (ISO)

Neurodevelopmental Disorders (ISO)

Peroxisome Biogenesis Disorder, Complementation Group 7 (ISO)

Shprintzen-Goldberg Craniosynostosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-amphetamine (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetaldehyde (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

Aroclor 1254 (EXP)

arotinoid acid (ISO)

arsenous acid (ISO)

avobenzone (ISO)

azoxystrobin (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

carbamazepine (ISO)

CHIR 99021 (ISO)

clofibrate (ISO)

cortisol (ISO)

crocidolite asbestos (ISO)

Cyclopamine (EXP)

cytarabine (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

entinostat (ISO)

flavonoids (EXP)

fluoxetine (EXP)

folic acid (EXP)

glycidol (EXP)

glyphosate (ISO)

iron dichloride (ISO)

ketamine (EXP)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

mercury dibromide (ISO)

methamphetamine (EXP)

methylmercury chloride (ISO)

ochratoxin A (EXP)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP)

poly(ethylene) (ISO)

progesterone (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

simvastatin (EXP)

sodium arsenite (ISO)

Soman (EXP)

tebufenpyrad (ISO)

thifluzamide (ISO)

thyroxine (EXP)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (EXP,ISO)

vorinostat (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterior/posterior pattern specification (IBA)

astrocyte differentiation (ISO,ISS)

BMP signaling pathway (ISO)

brain development (ISO,ISS)

camera-type eye development (ISO,ISS)

cartilage development (ISO,ISS)

cell adhesion (ISO,ISS)

cell maturation (ISO,ISS)

central nervous system myelination (ISO,ISS)

chondrocyte differentiation (ISO,ISS)

comma-shaped body morphogenesis (ISO)

establishment of epithelial cell polarity (ISO)

forebrain radial glial cell differentiation (IDA)

glial cell fate commitment (ISO,ISS)

inner ear auditory receptor cell differentiation (ISO)

inner ear receptor cell stereocilium organization (ISO)

metanephric nephron tubule morphogenesis (ISO)

negative regulation of astrocyte differentiation (ISO,ISS)

negative regulation of DNA-templated transcription (IDA,ISO)

negative regulation of forebrain neuron differentiation (IDA)

negative regulation of inner ear auditory receptor cell differentiation (ISO)

negative regulation of inner ear receptor cell differentiation (ISO)

negative regulation of neuron differentiation (ISO,ISS)

negative regulation of oligodendrocyte differentiation (ISO,ISS)

negative regulation of pro-B cell differentiation (IMP)

negative regulation of stem cell differentiation (ISO,ISS)

negative regulation of transcription by RNA polymerase II (IDA,ISO)

neural tube development (ISO,ISS)

neuron differentiation (IEP,ISO)

neuronal stem cell population maintenance (IDA,ISO)

Notch signaling pathway (ISO,ISS)

oligodendrocyte development (ISO,ISS)

oligodendrocyte differentiation (ISO)

positive regulation of BMP signaling pathway (ISO,ISS)

positive regulation of cell population proliferation (ISO,ISS)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of Notch signaling pathway (ISO)

positive regulation of receptor signaling pathway via JAK-STAT (ISO,ISS)

positive regulation of smooth muscle cell proliferation (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of tyrosine phosphorylation of STAT protein (ISO,ISS)

protein-containing complex assembly (ISO,ISS)

regulation of cell differentiation (ISO,ISS)

regulation of epithelial cell proliferation (ISO)

regulation of myelination (ISO,ISS)

regulation of neurogenesis (IBA,ISO,ISS)

regulation of neuron differentiation (ISO)

regulation of transcription by RNA polymerase II (IBA)

S-shaped body morphogenesis (ISO)

smoothened signaling pathway (ISO,ISS)

specification of loop of Henle identity (ISO)

telencephalon development (ISO,ISS)

Cellular Component

nucleus (IBA)

Molecular Function

chromatin binding (IDA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (ISO,ISS)

double-stranded DNA binding (IDA)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Notch signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular characterization of a rat negative regulator with a basic helix-loop-helix structure predominantly expressed in the developing nervous system.	Akazawa C, etal., J Biol Chem 1992 Oct 25;267(30):21879-85.
2.	Delta-Notch--and then? Protein interactions and proposed modes of repression by Hes and Hey bHLH factors.	Fischer A and Gessler M, Nucleic Acids Res. 2007;35(14):4583-96. Epub 2007 Jun 22.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Overexpression of the Notch target genes Hes in vivo induces lymphoid and myeloid alterations.	Kawamata S, etal., Oncogene. 2002 May 30;21(24):3855-63.
5.	A molecular insight of Hes5-dependent inhibition of myelin gene expression: old partners and new players.	Liu A, etal., EMBO J. 2006 Oct 18;25(20):4833-42. Epub 2006 Sep 28.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Roles of the basic helix-loop-helix genes Hes1 and Hes5 in expansion of neural stem cells of the developing brain.	Ohtsuka T, etal., J Biol Chem. 2001 Aug 10;276(32):30467-74. Epub 2001 Jun 8.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Triggering of a Dll4-Notch1 loop impairs wound healing in diabetes.	Zheng X, etal., Proc Natl Acad Sci U S A. 2019 Apr 2;116(14):6985-6994. doi: 10.1073/pnas.1900351116. Epub 2019 Mar 18.

Additional References at PubMed

PMID:10205173	PMID:10804175	PMID:10821751	PMID:11425898	PMID:12208538	PMID:12666205	PMID:15156153	PMID:15465493	PMID:15496443	PMID:15821257	PMID:15854743	PMID:16335396
PMID:17093926	PMID:17331197	PMID:17849174	PMID:18048645	PMID:18579678	PMID:19050759	PMID:19124651	PMID:19682396	PMID:19855400	PMID:20431123	PMID:21259317	PMID:21300049
PMID:22334042	PMID:25535395	PMID:30811836

Genomics

Comparative Map Data

Hes5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	165,522,138 - 165,523,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	165,522,234 - 165,523,001 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	168,227,682 - 168,228,449 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	170,049,096 - 170,049,863 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	170,011,628 - 170,012,395 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	172,364,421 - 172,365,188 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	172,364,421 - 172,365,188 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	175,820,392 - 175,821,159 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	171,763,869 - 171,764,636 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	171,774,363 - 171,775,131 (+)	NCBI
Celera	5	163,728,713 - 163,729,480 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

HES5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	2,528,745 - 2,530,263 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	2,528,745 - 2,530,263 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	2,460,184 - 2,461,702 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	2,450,044 - 2,451,544 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	2,492,347 - 2,493,846	NCBI
Celera	1	124,288 - 125,788 (+)	NCBI		Celera
Cytogenetic Map	1	p36.32	NCBI
HuRef	1	1,739,123 - 1,740,623 (-)	NCBI		HuRef
CHM1_1	1	2,446,941 - 2,448,441 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	1,970,389 - 1,971,907 (-)	NCBI		T2T-CHM13v2.0

Hes5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	155,042,358 - 155,046,829 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	155,045,380 - 155,046,828 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	154,960,626 - 154,962,372 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	154,960,923 - 154,962,371 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	154,335,032 - 154,336,480 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	153,804,723 - 153,806,171 (+)	NCBI		MGSCv36	mm8
Celera	4	157,232,968 - 157,234,416 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	86.01	NCBI

Hes5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	8,700,162 - 8,701,748 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	8,700,212 - 8,701,581 (+)	NCBI	ChiLan1.0	ChiLan1.0

HES5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	224,377,907 - 224,379,810 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	1,261,260 - 1,263,128 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

HES5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	57,387,961 - 57,389,412 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	57,388,674 - 57,389,388 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	5	57,592,177 - 57,593,619 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	57,592,171 - 57,593,605 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	57,583,534 - 57,584,976 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	57,475,854 - 57,477,292 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	57,865,566 - 57,867,005 (-)	NCBI		UU_Cfam_GSD_1.0

Hes5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	28,418,080 - 28,419,331 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936737	1,046,613 - 1,047,950 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936737	1,045,496 - 1,047,865 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HES5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	64,408,956 - 64,410,881 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	64,409,110 - 64,410,541 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

HES5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	129,023,750 - 129,028,790 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	129,027,370 - 129,028,065 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	33,373,940 - 33,375,505 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hes5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	7,516,189 - 7,518,734 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	7,516,279 - 7,517,654 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hes5
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	59
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000018769
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	154828214	166875058	Rat

Markers in Region

UniSTS:259615

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	165,522,293 - 165,522,823 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	172,364,481 - 172,365,010	NCBI	Rnor6.0
Rnor_5.0	5	175,820,452 - 175,820,981	UniSTS	Rnor5.0
RGSC_v3.4	5	171,763,929 - 171,764,458	UniSTS	RGSC3.4
Celera	5	163,728,773 - 163,729,302	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:265716

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	165,523,227 - 165,523,496 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	172,365,415 - 172,365,683	NCBI	Rnor6.0
Rnor_5.0	5	175,821,386 - 175,821,654	UniSTS	Rnor5.0
RGSC_v3.4	5	171,764,863 - 171,765,131	UniSTS	RGSC3.4
Celera	5	163,729,707 - 163,729,975	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:484887

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	165,522,260 - 165,523,215 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	172,364,448 - 172,365,402	NCBI	Rnor6.0
Rnor_5.0	5	175,820,419 - 175,821,373	UniSTS	Rnor5.0
RGSC_v3.4	5	171,763,896 - 171,764,850	UniSTS	RGSC3.4
Celera	5	163,728,740 - 163,729,694	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium					9				67		3
Low	2		5		7				7	10	10	3
Below cutoff	1	6	13	5	3	5	7	9		4	17	6	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D12516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000018769 ⟹ ENSRNOP00000018769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	165,522,234 - 165,523,001 (+)	Ensembl
Rnor_6.0 Ensembl	5	172,364,421 - 172,365,188 (+)	Ensembl

RefSeq Acc Id:

NM_024383 ⟹ NP_077359

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	165,522,234 - 165,523,001 (+)	NCBI
Rnor_6.0	5	172,364,421 - 172,365,188 (+)	NCBI
Rnor_5.0	5	175,820,392 - 175,821,159 (+)	NCBI
RGSC_v3.4	5	171,763,869 - 171,764,636 (+)	RGD
Celera	5	163,728,713 - 163,729,480 (+)	RGD

Sequence:

show sequence

CCTGGCTCTGCTCGCTCCGCTCCGCTCGCCAATCGCCTCCAGAGCTCCAGGCATGGCCCCAAGT
ACCGTGGCGGTGGAGATGCTCAGTCCCAAGGAGAAAAATCGACTGCGGAAGCCGGTGGTGGAGA
AGATGCGTCGGGACCGCATCAACAGCAGCATTGAGCAGCTGAAACTGCTGCTGGAGCAGGAGTT
CGCGCGGCACCAGCCCAACTCCAAACTGGAGAAGGCCGACATCCTGGAGATGGCCGTCAGCTAC
CTGAAGCACAGCAAAGCCTTCGCCGCGGCCGCCGGCCCCAAGAGCCTGCACCAGGACTACAGCG
AGGGTTACTCGTGGTGCCTGCAGGAGGCGGTGCAGTTCCTGACCCTGCATGCAGCCAGCGACAC
GCAGATGAAGCTGCTTTACCACTTCCAGCGGCCCCCAGCTCCCGCCGCGCCTGTCAAGGAGACC
CCGACGCCCGGCGCTGCGCCCCAGCCGGCGCGCTCCTCCACTAAGGCCGCCGCCTCCGTCTCCA
CCTCGCGCCAATCTGCCTGCGGCCTCTGGCGGCCCTGGTGACCCAGCGGCCGACGGGTGCCTGG
AGCTGACCAGAGGACC

hide sequence

RefSeq Acc Id:

XM_039110831 ⟹ XP_038966759

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	165,522,138 - 165,523,684 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_077359	(Get FASTA)	NCBI Sequence Viewer
	XP_038966759	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA02081	(Get FASTA)	NCBI Sequence Viewer
	EDL81280	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018769
GenBank Protein	Q03062	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077359 ⟸ NM_024383
- UniProtKB:	Q03062 (UniProtKB/Swiss-Prot), A6IUM9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEM AVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAP VKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRPW hide sequence

RefSeq Acc Id:

ENSRNOP00000018769 ⟸ ENSRNOT00000018769

RefSeq Acc Id:	XP_038966759 ⟸ XM_039110831
- Peptide Label:	isoform X1

Protein Domains

bHLH Orange

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q03062-F1-model_v2	AlphaFold	Q03062	1-166	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621340	AgrOrtholog
BioCyc Gene	G2FUF-38943	BioCyc
Ensembl Genes	ENSRNOG00000013850	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018769	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Orange_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79225	UniProtKB/Swiss-Prot
NCBI Gene	79225	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, HES-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR HES-5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Hairy_orange	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hes5	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ORANGE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013850	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ORANGE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	HLH, helix-loop-helix DNA-binding domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6IUM9	ENTREZGENE, UniProtKB/TrEMBL
	HES5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-11	Hes5	hes family bHLH transcription factor 5	Hes5	hairy and enhancer of split 5 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Hes5	hairy and enhancer of split 5 (Drosophila)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Hes5	hairy and enhancer of split 5 (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed only nervous system	728403

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)