Inhbc (inhibin subunit beta C) - Rat Genome Database

Name: Inhbc
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Inhbc (inhibin subunit beta C) Rattus norvegicus

Analyze

Symbol:

Inhbc

Name:

inhibin subunit beta C

RGD ID:

621194

Description:

Predicted to enable cytokine activity. Predicted to be involved in BMP signaling pathway; SMAD protein signal transduction; and positive regulation of pathway-restricted SMAD protein phosphorylation. Predicted to be active in extracellular space. Orthologous to human INHBC (inhibin subunit beta C); PARTICIPATES IN transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

activin beta-C chain; activin/inhibin beta C; inhibin beta C; inhibin beta C chain; inhibin beta C subunit; MGC108687

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	INHBC (inhibin subunit beta C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Inhbc (inhibin beta-C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Inhbc (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	INHBC (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	INHBC (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Inhbc (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	INHBC (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	INHBC (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Inhbc (inhibin subunit beta C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	INHBC (inhibin subunit beta C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Inhbc (inhibin beta-C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Actbeta	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	daw	Alliance	DIOPT (Hieranoid\|InParanoid\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	63,184,141 - 63,197,630 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	63,184,142 - 63,197,630 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	65,073,432 - 65,086,889 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	67,275,858 - 67,289,319 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	67,077,119 - 67,090,617 (-)	NCBI	Rnor_WKY
Rnor_6.0	7	70,648,005 - 70,661,475 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	70,646,519 - 70,661,891 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	70,822,284 - 70,835,753 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	67,315,295 - 67,328,764 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	67,336,025 - 67,349,494 (-)	NCBI
Celera	7	60,324,150 - 60,337,619 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Calcimycin (ISO)

CGP 52608 (ISO)

clofibric acid (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

DDT (EXP)

dexamethasone (ISO)

epoxiconazole (ISO)

flavonoids (EXP)

fulvestrant (ISO)

furan (EXP)

griseofulvin (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

methimazole (EXP)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

O-methyleugenol (ISO)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

triptonide (ISO)

troglitazone (EXP)

urethane (ISO)

valdecoxib (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of pathway-restricted SMAD protein phosphorylation (IBA)

SMAD protein signal transduction (IBA)

Cellular Component

extracellular space (IBA)

Molecular Function

cytokine activity (IBA)

growth factor activity (IEA)

hormone activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Overexpression of activin beta(C) or activin beta(E) in the mouse liver inhibits regenerative deoxyribonucleic acid synthesis of hepatic cells.	Chabicovsky M, etal., Endocrinology 2003 Aug;144(8):3497-504.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Expression and dimerization of the rat activin subunits betaC and betaE: evidence for the ormation of novel activin dimers.	Vejda S, etal., J Mol Endocrinol 2002 Apr;28(2):137-48.

Additional References at PubMed

PMID:12477932	PMID:15821113	PMID:16085335	PMID:23376485	PMID:32141565

Genomics

Comparative Map Data

Inhbc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	63,184,141 - 63,197,630 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	63,184,142 - 63,197,630 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	65,073,432 - 65,086,889 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	67,275,858 - 67,289,319 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	67,077,119 - 67,090,617 (-)	NCBI	Rnor_WKY
Rnor_6.0	7	70,648,005 - 70,661,475 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	70,646,519 - 70,661,891 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	70,822,284 - 70,835,753 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	67,315,295 - 67,328,764 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	67,336,025 - 67,349,494 (-)	NCBI
Celera	7	60,324,150 - 60,337,619 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

INHBC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	57,434,784 - 57,452,062 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	57,434,784 - 57,452,062 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	57,828,567 - 57,845,845 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	56,114,810 - 56,130,876 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	56,114,809 - 56,130,876	NCBI
Celera	12	57,482,525 - 57,498,596 (+)	NCBI		Celera
Cytogenetic Map	12	q13.3	NCBI
HuRef	12	54,866,296 - 54,882,363 (+)	NCBI		HuRef
CHM1_1	12	57,796,669 - 57,812,718 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	57,403,060 - 57,420,351 (+)	NCBI		T2T-CHM13v2.0

Inhbc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	127,192,191 - 127,206,417 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	127,192,191 - 127,206,300 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	127,356,322 - 127,370,548 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	127,356,322 - 127,370,431 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	126,793,381 - 126,807,600 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	126,759,271 - 126,773,379 (-)	NCBI		MGSCv36	mm8
Celera	10	129,748,821 - 129,762,882 (-)	NCBI		Celera
Cytogenetic Map	10	D3	NCBI
cM Map	10	74.5	NCBI

Inhbc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	5,148,923 - 5,173,136 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	5,148,923 - 5,173,136 (+)	NCBI	ChiLan1.0	ChiLan1.0

INHBC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	31,730,166 - 31,747,905 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	31,732,208 - 31,747,391 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	31,473,809 - 31,494,746 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

INHBC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	1,546,654 - 1,558,631 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	1,547,075 - 1,558,645 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	1,610,134 - 1,622,016 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	1,555,915 - 1,567,798 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	1,555,818 - 1,567,807 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	1,534,000 - 1,545,894 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	1,775,521 - 1,787,401 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	1,900,831 - 1,912,720 (+)	NCBI		UU_Cfam_GSD_1.0

Inhbc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	57,259,010 - 57,266,973 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936646	1,603,276 - 1,610,051 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936646	1,603,276 - 1,610,051 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

INHBC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	22,718,491 - 22,730,087 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	22,718,416 - 22,728,766 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	24,639,066 - 24,770,072 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

INHBC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	53,340,873 - 53,362,950 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	53,348,742 - 53,362,269 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	192,604,709 - 192,621,019 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Inhbc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624802	10,501,502 - 10,518,188 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624802	10,503,431 - 10,517,383 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Inhbc
27 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	320
Count of miRNA genes:	184
Interacting mature miRNAs:	217
Transcripts:	ENSRNOT00000010240
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	47251783	65728867	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			23	23		23
Low			28	12	16	12	7	7	8	8	8	9	7
Below cutoff	2	11	6	6	2	6	1	4	1	19	7	2	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF140031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010240 ⟹ ENSRNOP00000010240

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	63,184,142 - 63,197,630 (-)	Ensembl
Rnor_6.0 Ensembl	7	70,646,519 - 70,661,891 (-)	Ensembl

RefSeq Acc Id:

NM_022614 ⟹ NP_072136

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	63,184,141 - 63,197,630 (-)	NCBI
Rnor_6.0	7	70,648,005 - 70,661,475 (-)	NCBI
Rnor_5.0	7	70,822,284 - 70,835,753 (-)	NCBI
RGSC_v3.4	7	67,315,295 - 67,328,764 (-)	RGD
Celera	7	60,324,150 - 60,337,619 (-)	RGD

Sequence:

show sequence

CAGGGTCCCTGGTGGCCAGGACAGAGTTGAAGCTACTCCCGTTGAGACCCTGAACACAGGCGTT
GTGTCCTTTAAGGAGACCATCCTCCAGCAATGGCCTCCTCCTTGCTCCTGGCTCTTCTGTTCCT
GACTCTAGCCACAGTAGTGAACCTCAAAACTGATGGTCCATGTCCAGCATGTTGGGGTGCCACC
TTTGACCTGGAGAGCCATCGGGAGCTCCTTCTCGATTTGGCCAAGAAAAGCATCCTGGACAAGC
TGCACCTCAGCCAGCGCCCCATACTCAGTCGGCCTGTGTCCAGAGAGGCCCTCAAGACCGCGCT
GCGGCGCCTCCGTGGGACTCGAGCGGAAACCCTGTTGGAGCATGACCAGAGACAAGAATATGAG
ATCATCAGCTTTGCTGACACAGGCCTCTCCAACATCAACCAAACCCGTCTTGAATTCCATTTCT
CTGATAGAACTACTGGTGGTGTGGAGGTCCTGCAGACCCGTTTCATGTTCTTCATGCAGCTCCC
TCCCAACACCACCCAGACCATGAATATAAGAGTTCTTGTGCTAAGGCCATATGACACCAACCTC
ACCTTGACAAGCCAGTACATGCTGCAGGTGGATGCCAGTGGCTGGTACCAGCTTCTCCTAGGAC
CCGAAGCTCAAGCTGCTTGCAGTCAGGGGCACCTCACTCTGGAGCTGGTGCCAGAAAGTCAGCT
GGCCCACAGTTCCTTGATCCTGGATGGGGTTTCCCACAGGCCTTTTGTGGCAGCCCAGGTAAGA
GTTGAAGGCAAGCATCGGGTACGCCGGCGAGGTATCAACTGCCAGGGGCTGTCCAGGATGTGCT
GTCGGCAAGAGTTCTTTGTGGACTTCCGTGAGATTGGCTGGCATGACTGGATCATCCAGCCCGA
AGGCTATGCCATGAACTTCTGCACTGGGCAGTGCCCACTACATGTGGCAGGCATGCCTGGCATC
TCTGCGTCCTTTCACACTGCAGTGCTGAATCTGCTCAAAGCCAACACAGATGCTGGCACTGCCC
GCAGGGGCTCATGCTGCGTGCCTACGTCTCGGCGCCCTCTGTCTTTGCTCTACTATGACAGGGA
CAGCAACATTGTCAAGACGGATATACCTGACATGGTGGTAGAGGCCTGTGGGTGCAGTTAGCTT
ATGTGTGATATAGGCAGCCTGAGGTAGAGCAGCAGCCTGAGGTAGAGCGGCCTTCCCCAGGACG
GGGTGACTCTGCTCTGGCTTCTGTCCAGAAAGTAAGCGCCTTCTTTCTAAGCATACAGACATCC
CTCCGTTGACTCCAGGAGATCCACCTCTAAAGGGAGTCACTCATGATCAACAGCCTTTCTCTCC
CCTTGGACATGGTTGACCCAGTATACCCACATCTTCAGCTAGGCCAGGGGCTAATCCACTGCCA
ACCACAAGCAGTATCATTTCATTTCCAGCAAACACATCCTTAGTTCACCCTTAGTCAACTATGT
CACCTACTCTGCCTCCCTGACCTGCCACCTGAGGCTCCCACCGAGATGACGTGCCTTAGTATCT
CCTCTTGAATTCTATGGCTCTCCCAAGAGTCCTTTCCTCAGCTTCACTAAAGATTATACCGCTG
TCTTCCAAAGCAAGGCGCAGCTCTCAGATCTCGAGACCCTCACCCAGATGTGCTGCTAAATGCT
GTCTGCACAGCTTCCAGAGTTCTCTGCCCTCCTCTGCCCTGGTGGGTGGCATACCAAGACTCAT
CACCTGAACTCTCCTACCCAACTGAACTTGACCAAAGGGAGACTCAGGTTGGAAACAAAATCCC
AGGATGATACACGGAAAAACTCCATTAGGCACAGTGACATACATGTGTAATTCAAACGCTGCAC
TTGAGAGACTGAGGCAGGAGGAGATCTATCGAAAGGTTGAGACCAACTAGCTGTAGGCTAGCCT
GGGCTATGCTGTTAAGACCTTGTCACAAAGTACAAGAAGGGAGAATAAAAGAATATTTCCTAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_072136	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD30132	(Get FASTA)	NCBI Sequence Viewer
	AAH89799	(Get FASTA)	NCBI Sequence Viewer
	EDM16468	(Get FASTA)	NCBI Sequence Viewer
	Q9WUK5	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_072136 ⟸ NM_022614
- Peptide Label:	precursor
- UniProtKB:	Q5FVS9 (UniProtKB/Swiss-Prot), Q9WUK5 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASSLLLALLFLTLATVVNLKTDGPCPACWGATFDLESHRELLLDLAKKSILDKLHLSQRPILS RPVSREALKTALRRLRGTRAETLLEHDQRQEYEIISFADTGLSNINQTRLEFHFSDRTTGGVEV LQTRFMFFMQLPPNTTQTMNIRVLVLRPYDTNLTLTSQYMLQVDASGWYQLLLGPEAQAACSQG HLTLELVPESQLAHSSLILDGVSHRPFVAAQVRVEGKHRVRRRGINCQGLSRMCCRQEFFVDFR EIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTS RRPLSLLYYDRDSNIVKTDIPDMVVEACGCS hide sequence

RefSeq Acc Id:

ENSRNOP00000010240 ⟸ ENSRNOT00000010240

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WUK5-F1-model_v2	AlphaFold	Q9WUK5	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695260

Promoter ID:

EPDNEW_R5785

Type:

initiation region

Name:

Inhbc_1

Description:

inhibin beta C subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	70,661,485 - 70,661,545	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621194	AgrOrtholog
BioCyc Gene	G2FUF-33746	BioCyc
Ensembl Genes	ENSRNOG00000007700	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000010240	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010240	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7321367	IMAGE-MGC_LOAD
InterPro	Cystine-knot_cytokine	UniProtKB/Swiss-Prot
	Inhibin_betaC	UniProtKB/Swiss-Prot
	TGF-b_C	UniProtKB/Swiss-Prot
	TGF-beta-rel	UniProtKB/Swiss-Prot
	TGFb_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:64549	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108687	IMAGE-MGC_LOAD
NCBI Gene	64549	ENTREZGENE
PANTHER	PTHR11848	UniProtKB/Swiss-Prot
Pfam	TGF_beta	UniProtKB/Swiss-Prot
PhenoGen	Inhbc	PhenoGen
PRINTS	INHIBINBC	UniProtKB/Swiss-Prot
PROSITE	TGF_BETA_1	UniProtKB/Swiss-Prot
	TGF_BETA_2	UniProtKB/Swiss-Prot
SMART	TGFB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57501	UniProtKB/Swiss-Prot
UniProt	INHBC_RAT	UniProtKB/Swiss-Prot
	Q5FVS9	ENTREZGENE
	Q9WUK5	ENTREZGENE
UniProt Secondary	Q5FVS9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-25	Inhbc	inhibin subunit beta C	Inhbc	inhibin beta C subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-06-01	Inhbc	inhibin beta C subunit	Inhbc	inhibin beta C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Inhbc	inhibin beta C		activin/inhibin beta C	Name updated	1299863	APPROVED
2002-08-07	Inhbc	activin/inhibin beta C			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	forms homo- and hetero-dimers with other activin beta subunits
gene_product	member of the transforming growth factor beta family

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)