Dars1 (aspartyl-tRNA synthetase 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Dars1 (aspartyl-tRNA synthetase 1) Rattus norvegicus

Analyze

Symbol:

Dars1

Name:

aspartyl-tRNA synthetase 1

RGD ID:

621167

Description:

Predicted to enable RNA binding activity and aspartate-tRNA ligase activity. Predicted to be involved in aspartyl-tRNA aminoacylation. Predicted to be located in cytoplasm and synapse. Predicted to be part of aminoacyl-tRNA synthetase multienzyme complex. Predicted to be active in cytosol. Orthologous to human DARS1 (aspartyl-tRNA synthetase 1); PARTICIPATES IN Canavan disease pathway; aminoacyl-tRNA biosynthetic pathway; INTERACTS WITH 2,4-dinitrotoluene; 3-chloropropane-1,2-diol; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

aspartate--tRNA ligase; aspartate--tRNA ligase, cytoplasmic; aspartyl-tRNA synthetase; aspartyl-tRNA synthetase, cytoplasmic; aspRS; Dars; DRS1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DARS1 (aspartyl-tRNA synthetase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dars1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dars1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DARS1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DARS1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dars1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DARS1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DARS1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dars1 (aspartyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FZD10 (frizzled class receptor 10)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DARS1 (aspartyl-tRNA synthetase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dars1 (aspartyl-tRNA synthetase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dars (aspartyl-tRNA synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AspRS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DPS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dars-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dars1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	39,857,936 - 39,913,055 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	39,857,936 - 39,913,116 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	42,451,676 - 42,506,974 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	43,739,779 - 43,795,077 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	40,993,748 - 41,048,901 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	45,074,067 - 45,127,815 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	45,074,072 - 45,127,815 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	50,158,677 - 50,212,300 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	41,077,395 - 41,132,513 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	41,090,911 - 41,146,678 (-)	NCBI
Celera	13	40,231,977 - 40,287,207 (-)	NCBI		Celera
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Hypomyelination with Brainstem and Spinal Cord Involvement and Leg Spasticity (ISO)

WHIM syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

5-fluorouracil (ISO)

7,12-dimethyltetraphene (ISO)

acrolein (ISO)

aflatoxin B1 (EXP)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

chrysene (ISO)

clofibrate (EXP)

clofibric acid (EXP)

copper(II) sulfate (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

ethanol (ISO)

finasteride (EXP)

flusilazole (ISO)

flutamide (EXP)

folic acid (ISO)

genistein (EXP)

hexaconazole (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead diacetate (EXP)

methapyrilene (EXP)

methylmercury chloride (ISO)

nefazodone (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

Propiverine (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

tanespimycin (ISO)

tert-butyl hydroperoxide (ISO)

tetraphene (ISO)

triadimefon (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aspartyl-tRNA aminoacylation (IBA,IEA)

Cellular Component

aminoacyl-tRNA synthetase multienzyme complex (IBA,ISO,ISS,TAS)

cytoplasm (IEA,ISO)

cytosol (IBA,ISO)

synapse (ISO)

Molecular Function

aspartate-tRNA ligase activity (IBA,IEA)

ATP binding (IEA)

nucleic acid binding (IEA)

protein binding (IPI,ISO)

RNA binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

aminoacyl-tRNA biosynthetic pathway (IEA)

Canavan disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Genomic organization of the rat aspartyl-tRNA synthetase gene family: a single active gene and several retropseudogenes.	Lazard M, etal., Gene 1996 Nov 21;180(1-2):197-205.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Molecular cloning and primary structure of cDNA encoding the catalytic domain of rat liver aspartyl-tRNA synthetase.	Mirande M and Waller JP, J Biol Chem 1989 Jan 15;264(2):842-7.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.	The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.	Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.

Additional References at PubMed

PMID:12060739	PMID:15489334	PMID:18064521	PMID:19131329	PMID:19289464	PMID:19946888	PMID:20458337	PMID:22658674	PMID:23106098	PMID:24625528	PMID:27816769	PMID:29476059
PMID:30361391	PMID:33450132

Genomics

Comparative Map Data

Dars1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	39,857,936 - 39,913,055 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	39,857,936 - 39,913,116 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	42,451,676 - 42,506,974 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	43,739,779 - 43,795,077 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	40,993,748 - 41,048,901 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	45,074,067 - 45,127,815 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	45,074,072 - 45,127,815 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	50,158,677 - 50,212,300 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	41,077,395 - 41,132,513 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	41,090,911 - 41,146,678 (-)	NCBI
Celera	13	40,231,977 - 40,287,207 (-)	NCBI		Celera
Cytogenetic Map	13	q13	NCBI

DARS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	135,905,881 - 135,985,684 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	135,905,881 - 135,986,100 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	136,663,451 - 136,743,254 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	136,380,724 - 136,459,692 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	136,497,985 - 136,576,954	NCBI
Celera	2	130,374,979 - 130,453,946 (-)	NCBI		Celera
Cytogenetic Map	2	q21.3	NCBI
HuRef	2	128,656,738 - 128,735,990 (-)	NCBI		HuRef
CHM1_1	2	136,669,650 - 136,748,607 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	136,350,305 - 136,430,110 (-)	NCBI		T2T-CHM13v2.0

Dars1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	128,291,444 - 128,345,153 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	128,291,444 - 128,345,105 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	128,363,707 - 128,417,416 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	128,363,707 - 128,417,368 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	130,260,284 - 130,313,993 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	130,191,253 - 130,244,884 (-)	NCBI		MGSCv36	mm8
Celera	1	130,992,060 - 131,045,578 (-)	NCBI		Celera
Cytogenetic Map	1	E3	NCBI
cM Map	1	55.8	NCBI

Dars1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955440	3,266,821 - 3,345,808 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955440	3,268,648 - 3,345,808 (-)	NCBI	ChiLan1.0	ChiLan1.0

DARS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2B	38,960,584 - 39,040,041 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	23,876,931 - 23,956,032 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	139,977,483 - 140,056,836 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	139,977,483 - 140,056,836 (-)	Ensembl	panpan1.1		panPan2

DARS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	38,690,170 - 38,751,360 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	38,668,527 - 38,751,310 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	38,933,151 - 38,994,341 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	40,135,547 - 40,196,455 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	40,135,551 - 40,196,464 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	38,777,495 - 38,838,663 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	38,937,306 - 38,998,504 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	40,169,840 - 40,230,688 (-)	NCBI		UU_Cfam_GSD_1.0

Dars1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	101,638,433 - 101,696,530 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	39,921,120 - 39,979,323 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936469	39,921,182 - 39,979,297 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DARS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	15,810,618 - 15,885,706 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	15,810,497 - 15,885,706 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	18,269,726 - 18,344,247 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DARS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	20,120,999 - 20,202,019 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	20,119,914 - 20,201,991 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666061	2,261,198 - 2,342,266 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dars1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	35,266,830 - 35,337,645 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624732	35,266,830 - 35,337,610 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dars1
248 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	223
Count of miRNA genes:	151
Interacting mature miRNAs:	169
Transcripts:	ENSRNOT00000005127
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738036	Lnnr4	Liver neoplastic nodule remodeling QTL 4	3.64		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	1	42356786	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
61339	Bp24	Blood pressure QTL 24		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	5994668	44807491	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	9313465	54313465	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	9313465	54313465	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	9831541	54831541	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	9831541	54831541	Rat
1300163	Cardf1	Cardiac cell morphology QTL 1	4.18		aorta morphology trait (VT:0000272)	artery lesion measurement (CMO:0000975)	13	11929449	45417941	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	11929449	46193066	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	14915655	59915655	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	15158722	60158722	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	17694436	53050594	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	22301875	67301875	Rat
70170	Eae14	Experimental allergic encephalomyelitis QTL 14		0.0024	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	23203448	68203448	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	23692969	68692969	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	23692969	68692969	Rat
2303030	Bp327	Blood pressure QTL 327			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	30395351	41184251	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	31241331	58363171	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
2292232	Pur16	Proteinuria QTL 16	17.2		urine total protein amount (VT:0000032)	urine protein level (CMO:0000591)	13	36155723	41961389	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	10	74	35	38	11	8
Low								1			3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB294577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB294578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH006763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000005127 ⟹ ENSRNOP00000005127

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	39,857,942 - 39,913,116 (-)	Ensembl
Rnor_6.0 Ensembl	13	45,074,072 - 45,127,815 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101975 ⟹ ENSRNOP00000089006

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	39,857,936 - 39,913,032 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106859 ⟹ ENSRNOP00000093114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	39,909,299 - 39,913,116 (-)	Ensembl

RefSeq Acc Id:

NM_053799 ⟹ NP_446251

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	39,857,936 - 39,913,055 (-)	NCBI
Rnor_6.0	13	45,074,072 - 45,127,815 (-)	NCBI
Rnor_5.0	13	50,158,677 - 50,212,300 (-)	NCBI
RGSC_v3.4	13	41,077,395 - 41,132,513 (-)	RGD
Celera	13	40,231,977 - 40,287,207 (-)	NCBI

Sequence:

show sequence

CGCGGAGTCTGGGGGCTTAAAACAAGGACTGGGAGGGCCAGCCTGCGGGAGGGAGACGTTTTTT
AGCCTGTCCTACGGAAGCCTGCGAGGGAGGGTGGTATCCACTCCCCCAATCCAGTGTCCTGATG
CCCAGCGCCAACGCCAGCCGTAAGGGTCAGGAGAAGCCGCGGGAGATCGTGGACGCGGCGGAAG
ATTATGCTAAAGAGAGATATGGGGTATCCTCTATGATACAATCACAAGAAAAACCAGATAGAGT
GTTGGTTCGAGTTAAGGATCTGACAGTACAAAAAGCTGATGAGGTTGTTTGGGTCCGTGCAAGA
GTTCATACAAGCAGAGCAAAAGGGAAGCAGTGCTTCTTAGTCCTGAGGCAGCAGCAGTTTAATG
TCCAGGCTCTTGTGGCGGTGGGAGACCATGCAAGCAAGCAGATGGTGAAATTTGCTGCCAACAT
CAACAAAGAAAGTATTATTGACGTAGAAGGCATTGTGAGAAAAGTAAATCAGAAAATTGGAAGC
TGTACACAGCAGGATGTTGAGTTGCACGTCCAGAAGATTTATGTGATTAGCTTGGCTGAGCCTC
GCCTGCCCTTGCAGCTGGATGATGCCATTCGGCCTGAGGTGGAAGGAGAAGAGGACGGGAGAGC
TACCGTTAACCAAGATACAAGATTAGACAACAGAATCATTGACCTTAGGACATCAACCAGCCAG
GCCATCTTCCATCTCCAGTCCGGCATTTGCCATCTCTTCCGAGAAACGTTAATTAACAAAGGTT
TTGTGGAAATCCAGACTCCTAAAATAATTTCAGCTGCCAGCGAAGGAGGAGCCAATGTTTTTAC
TGTGTCTTATTTTAAAAGTAATGCCTACCTCGCTCAGTCTCCACAGCTATATAAGCAGATGTGC
ATTTGTGCTGATTTTGAGAAGGTTTTCTGCATTGGGCCAGTTTTCAGAGCTGAAGACTCCAATA
CCCATAGACATCTGACTGAATTTGTTGGTTTGGATATTGAAATGGCCTTTAATTATCATTACCA
TGAAGTTGTAGAAGAGATCGCTGACACTTTGGTGCAAATATTCAAAGGACTTCAAGAAAGGTTT
CAGACTGAAATCCAAACTGTAAACAAACAGTTCCCATGTGAGCCGTTCAAATTTTTGGAGCCAA
CTTTAAGACTGGAGTATTGTGAGGCTTTGGCTATGCTTAGAGAAGCCGGAGTTGAAATGGACGA
TGAGGAAGATCTGAGTACACCAAATGAAAAACTGTTGGGTCGTTTGGTGAAGGAAAAGTATGAT
ACAGACTTTTATGTTCTTGATAAATATCCATTGGCTGTAAGACCTTTCTATACCATGCCTGACC
CAAGAAATCCTAAGCAGTCCAACTCTTACGATATGTTCATGAGAGGAGAAGAAATATTGTCTGG
AGCACAAAGAATACATGATCCTCAGTTGCTTACAGAGAGAGCTTTACACCATGGAATTGATTTG
GAGAAAATAAAAGCTTACATTGATTCCTTCCGCTTTGGAGCCCCTCCTCACGCTGGTGGCGGCA
TTGGGTTGGAAAGAGTGACGATGCTGTTTTTAGGATTGCATAATGTACGTCAGACCTCAATGTT
CCCTCGTGACCCGAAGCGACTCACGCCTTAAAGCCACACTTTTTATTCTCTCTAGTAACCTGCT
GTTGATTAGCTTATACCTGAGGTACTTAAGATATGCAGTAGAATTAATGCATTACTAAAGTGCC
ACAATTATTTTTTAAGTAGCTCAATACGAATTCATTTAAGTCAAAACGTTTTAGAACTTCAGAT
ATGCTTAAATAGGAAATACTTGAACATTTTAATGAGAAATTTCTATGGTTGAAATTCATAGTCT
ATCACTATAGGAAATGTTAAGGACAATTTAAACAGTTTAGGATTATATAATTTTTTTTTCTTTT
CTATATTGTGGTGACCACCATACTAATATCCTAAATTTTCAATATTTGAACTTTTAACTCTTGA
CATTGAGAAAAAAAATTGGAGAAATTACCAAGATTTTAACATATATAAAACTGGTATGTCTTAA
AAGTTACTTTCAGAAATCATGTAAAGTATCTGAAAACACTGGCTAGAAGCAGTAACACTGAAAC
CTTGTTATCAATTCTGAGGCTGAAATTCAATAAAAACTTAAAGCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446251	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40789	(Get FASTA)	NCBI Sequence Viewer
	AAC52981	(Get FASTA)	NCBI Sequence Viewer
	AAH72534	(Get FASTA)	NCBI Sequence Viewer
	BAF94235	(Get FASTA)	NCBI Sequence Viewer
	BAF94255	(Get FASTA)	NCBI Sequence Viewer
	EDM09873	(Get FASTA)	NCBI Sequence Viewer
	P15178	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446251 ⟸ NM_053799

- UniProtKB:

P15178 (UniProtKB/Swiss-Prot), A9CMB7 (UniProtKB/TrEMBL), A9CMD0 (UniProtKB/TrEMBL), A0A8I6GHP5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPSANASRKGQEKPREIVDAAEDYAKERYGVSSMIQSQEKPDRVLVRVKDLTVQKADEVVWVRA
RVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIIDVEGIVRKVNQKIG
SCTQQDVELHVQKIYVISLAEPRLPLQLDDAIRPEVEGEEDGRATVNQDTRLDNRIIDLRTSTS
QAIFHLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKSNAYLAQSPQLYKQM
CICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVVEEIADTLVQIFKGLQER
FQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMDDEEDLSTPNEKLLGRLVKEKY
DTDFYVLDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGID
LEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP

hide sequence

RefSeq Acc Id:

ENSRNOP00000005127 ⟸ ENSRNOT00000005127

RefSeq Acc Id:

ENSRNOP00000093114 ⟸ ENSRNOT00000106859

RefSeq Acc Id:

ENSRNOP00000089006 ⟸ ENSRNOT00000101975

Protein Domains

Aminoacyl-transfer RNA synthetases class-II family

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P15178-F1-model_v2	AlphaFold	P15178	1-501	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621167	AgrOrtholog
BioCyc Gene	G2FUF-18407	BioCyc
BioCyc Pathway	TRNA-CHARGING-PWY [tRNA charging]	BioCyc
Ensembl Genes	ENSRNOG00000003743	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000005127	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000089006.1	UniProtKB/TrEMBL
	ENSRNOP00000093114.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005127	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000101975.1	UniProtKB/TrEMBL
	ENSRNOT00000106859.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7098427	IMAGE-MGC_LOAD
InterPro	aa-tRNA-synt_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	aa-tRNA-synth_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	aa-tRNA-synth_II/BPL/LPL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Asp-tRNA_synthase_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Asp/Asn-tRNA-synth_IIb	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA-bd_OB-fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA-bd_OB_tRNA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:116483	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91557	IMAGE-MGC_LOAD
NCBI Gene	116483	ENTREZGENE
PANTHER	ASPARTATE--TRNA LIGASE, CYTOPLASMIC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR43450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	tRNA-synt_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	tRNA_anti-codon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dars1	PhenoGen
PRINTS	TRNASYNTHASP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	AA_TRNA_LIGASE_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50249	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF55681	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6GHP5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GK46_RAT	UniProtKB/TrEMBL
	A9CMB7	ENTREZGENE, UniProtKB/TrEMBL
	A9CMD0	ENTREZGENE, UniProtKB/TrEMBL
	P15178	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-08-13	Dars1	aspartyl-tRNA synthetase 1	Dars	aspartyl-tRNA synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Dars	aspartyl-tRNA synthetase			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Dars	aspartyl-tRNA synthetase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)