Emb (embigin) - Rat Genome Database

Name: Emb
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Emb (embigin) Rattus norvegicus

Analyze

Symbol:

Emb

Name:

embigin

RGD ID:

621067

Description:

Predicted to enable cell-cell adhesion mediator activity. Involved in cell adhesion and plasma membrane lactate transport. Located in plasma membrane. Orthologous to human EMB (embigin); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

embigin homolog; embigin homolog (mouse)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EMB (embigin)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Emb (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Emb (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EMB (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EMB (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Emb (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EMB (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EMB (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Emb (embigin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KCTD6 (potassium channel tetramerization domain containing 6)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Emb (embigin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	EMB (embigin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	emb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	emb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	49,070,509 - 49,125,042 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	49,069,087 - 49,125,050 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	56,185,272 - 56,239,842 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	54,243,931 - 54,298,501 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	49,129,728 - 49,184,290 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	49,682,763 - 49,733,475 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	49,682,754 - 49,732,253 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	68,054,533 - 68,107,895 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	49,098,743 - 49,155,221 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	49,026,975 - 49,083,453 (+)	NCBI
Celera	2	44,782,309 - 44,836,695 (+)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic contact dermatitis (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (EXP,ISO)

all-trans-retinoic acid (ISO)

Allylamine (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlordecone (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

curcumin (ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (EXP)

dioxygen (EXP)

disodium selenite (ISO)

eugenol (ISO)

flavonoids (EXP)

folic acid (ISO)

gentamycin (EXP)

hexachlorobenzene (EXP)

indole-3-methanol (EXP)

L-methionine (ISO)

leflunomide (ISO)

maneb (ISO)

metformin (EXP)

methylparaben (ISO)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

oxaliplatin (EXP)

paracetamol (ISO)

paraquat (ISO)

phenacetin (EXP)

phenylhydrazine (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

rotenone (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

testosterone (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

tungsten (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (IBA,IEA)

cell adhesion (IDA,IEA)

dendrite self-avoidance (IBA)

homophilic cell adhesion via plasma membrane adhesion molecules (IBA)

plasma membrane lactate transport (IDA,IMP)

Cellular Component

axon (IBA)

plasma membrane (IBA,IDA,IEA)

synapse (IEA)

Molecular Function

cell-cell adhesion mediator activity (IBA)

protein binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Embigin, a developmentally expressed member of the immunoglobulin super family, is also expressed during regression of prostate and mammary gland.	Guenette RS, etal., Dev Genet 1997;21(4):268-78.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	The inhibition of monocarboxylate transporter 2 (MCT2) by AR-C155858 is modulated by the associated ancillary protein.	Ovens MJ, etal., Biochem J. 2010 Oct 15;431(2):217-25. doi: 10.1042/BJ20100890.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	Basigin (CD147) is the target for organomercurial inhibition of monocarboxylate transporter isoforms 1 and 4: the ancillary protein for the insensitive MCT2 is EMBIGIN (gp70).	Wilson MC, etal., J Biol Chem. 2005 Jul 22;280(29):27213-21. Epub 2005 May 24.
10.	Studies on the DIDS-binding site of monocarboxylate transporter 1 suggest a homology model of the open conformation and a plausible translocation cycle.	Wilson MC, etal., J Biol Chem. 2009 Jul 24;284(30):20011-21. doi: 10.1074/jbc.M109.014217. Epub 2009 May 27.

Additional References at PubMed

PMID:15489334	PMID:19164284	PMID:30446621

Genomics

Comparative Map Data

Emb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	49,070,509 - 49,125,042 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	49,069,087 - 49,125,050 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	56,185,272 - 56,239,842 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	54,243,931 - 54,298,501 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	49,129,728 - 49,184,290 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	49,682,763 - 49,733,475 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	49,682,754 - 49,732,253 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	68,054,533 - 68,107,895 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	49,098,743 - 49,155,221 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	49,026,975 - 49,083,453 (+)	NCBI
Celera	2	44,782,309 - 44,836,695 (+)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

EMB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	50,396,192 - 50,443,345 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	50,396,192 - 50,443,248 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	49,692,026 - 49,737,122 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	49,730,230 - 49,772,958 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	49,730,233 - 49,772,958	NCBI
Celera	5	46,639,392 - 46,684,611 (-)	NCBI		Celera
Cytogenetic Map	5	q11.1	NCBI
HuRef	5	46,656,951 - 46,701,888 (-)	NCBI		HuRef
CHM1_1	5	49,694,085 - 49,739,302 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	51,215,328 - 51,262,447 (-)	NCBI		T2T-CHM13v2.0

Emb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	117,357,109 - 117,410,951 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	117,345,072 - 117,410,951 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	117,220,573 - 117,274,415 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	117,208,536 - 117,274,415 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	118,009,380 - 118,063,222 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	118,339,913 - 118,393,379 (+)	NCBI		MGSCv36	mm8
Celera	13	121,622,857 - 121,676,167 (+)	NCBI		Celera
Cytogenetic Map	13	D2.3	NCBI
cM Map	13	65.4	NCBI

Emb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955446	16,716,677 - 16,753,841 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955446	16,716,677 - 16,757,031 (+)	NCBI	ChiLan1.0	ChiLan1.0

EMB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	61,655,719 - 61,702,735 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	63,590,589 - 63,635,167 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	65,203,820 - 65,250,260 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	65,204,168 - 65,247,182 (+)	Ensembl	panpan1.1		panPan2

EMB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	64,409,497 - 64,460,215 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	64,409,589 - 64,459,376 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	64,169,708 - 64,219,478 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	64,907,837 - 64,957,630 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	64,907,865 - 64,956,791 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	64,672,241 - 64,720,515 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	64,795,117 - 64,843,296 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	65,328,657 - 65,378,436 (+)	NCBI		UU_Cfam_GSD_1.0

Emb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	207,717,925 - 207,770,608 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	16,654,092 - 16,704,186 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936480	16,654,388 - 16,705,112 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EMB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	30,120,493 - 30,287,793 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	30,121,072 - 30,170,495 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	31,718,891 - 31,763,638 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EMB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	46,678,490 - 46,730,944 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	46,681,540 - 46,730,472 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666082	4,484,344 - 4,536,366 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Emb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624759	9,085,231 - 9,157,643 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Emb
304 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	299
Count of miRNA genes:	198
Interacting mature miRNAs:	220
Transcripts:	ENSRNOT00000015306
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
738012	Anxrr3	Anxiety related response QTL 3	3.8		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	2	9023519	54023519	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
1300160	Hrtrt3	Heart rate QTL 3	3.62		heart pumping trait (VT:2000009)	absolute change in heart rate (CMO:0000534)	2	29971593	51729300	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
12879863	Bp402	Blood pressure QTL 402		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	41125789	56532139	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	42804607	60653831	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	43171017	83575226	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	8	32	24	19	24			73	34	35	10
Low	1	35	25	17		17	8	10	1	1	6	1	8
Below cutoff								1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ009698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000079907 ⟹ ENSRNOP00000069012

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	49,070,496 - 49,120,929 (+)	Ensembl
Rnor_6.0 Ensembl	2	49,682,754 - 49,731,546 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085576 ⟹ ENSRNOP00000069959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	49,070,496 - 49,125,050 (+)	Ensembl
Rnor_6.0 Ensembl	2	49,682,853 - 49,732,253 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108249 ⟹ ENSRNOP00000078563

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	49,069,087 - 49,125,050 (+)	Ensembl

RefSeq Acc Id:

NM_053719 ⟹ NP_446171

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	49,070,509 - 49,125,042 (+)	NCBI
Rnor_6.0	2	49,682,763 - 49,733,475 (+)	NCBI
Rnor_5.0	2	68,054,533 - 68,107,895 (+)	NCBI
RGSC_v3.4	2	49,098,743 - 49,155,221 (+)	RGD
Celera	2	44,782,309 - 44,836,695 (+)	RGD

Sequence:

show sequence

TTACCAGCAAGTGTGCATAGGGACAAACGGAGACCGATCGCAGCAGGCTGAGGGTGCAATAACG
ACCTCCTGGACCGACCCGCCCGCGCCATGCGCTCGCACACTGGCTTGAGGGCGCTTGTGGCGCC
TGGTTGCTCGCTCCTCCTTCTATATCTTCTGGCGGCGACGCGCCCGGATCGGGCTGTGGGCGAT
CCCGCAGACTCAGCGTTTACAAGTCTACCTGTTCGAGAGGAAATGATGGCTAAGTACGCAAATC
TGTCCTTGGAGACCTATAATATCTCACTGACAGAACAGACCAGAGTATCAGAACAAAACATAAC
TTTGGAAAGACCTTCTCACCTGGAACTCGAATGCACGTTCACGGCAACTGAGGATGTGATGTCA
ATGAATGTGACTTGGAAGAAAGATGACGCGCTCCTTGAGACTACTGATGGTTTCAATACAACTA
AAATGGGGGACACCTTATACAGTCAATACAGGTTCACCGTTTTTAATAGCAAACAAATGGGAAA
ATACTCTTGTTTCCTTGGAGAAGAGCTCAGAGGAACCTTTAATATCAGAGTACCCAAAGTTCAT
GGGAAAAACAAGCCTTTGATCACTTACGTGGGGGATTCTACTGTGCTGAAGTGTGAATGTCAAA
ATTGTCTTCCTTTAAATTGGACTTGGTACATGAGTAATGGAACTGCACAGGTTCCCATCGATGT
TCACGTGAATGATAAGTTTGATATAAATGGTTCCTATGCTAACGAAACAAAGCTCAAGGTAAAG
CACCTTTTGGAGGAAGATGGAGGATCCTACTGGTGCCGGGCAGCCTTCCCGTTAGGGGAGAGTG
AGGAACACATTAAGCTGGTTGTGCTGAGTTTCATGGTGCCTCTCAAGCCATTCCTTGCCATAAT
TGCTGAAGTCATCCTCTTAGTGGCCATCATCCTGCTTTGTGAAGTGTACACGCAGAAGAAAAAG
AATGACCCAGATGATGGGAAAGAATTTGAACAAATCGAACAGTTGAAATCAGATGATAGCAATG
GAATAGAAAACAATGTCCCCCGGTACAGAAAAACGGACTCTGGGGATCAGTGAATCCAAAAAGA
ACTTTTTGCCTTGGGAAGACGTACAGCACTGGAGTTTGAATTTCAGCATTCATTGGAGAACATC
CGAGTTTTAGATTTTTCCGAAGACAAAGATGCCCTCACTGTGCCCAGGAGTAGTTTCGTAAACA
ATATAGACCATCTCCTACCTAAAGATGTATTTTCATTGTGTAATTGCTTTTCATTAAAGCAAGG
TACATTGTTTCAGCTGTGTTCTGTGAGCTGTAACCTAGATAATAAAGTTTACCCTCTCTGGGAG
ATCAGGGGGACAGGGCAGACACCAGCAAAATCAGTTAATAACCCACAAAGTAAATATTGCTAAA
GATCTGTTTATTACCAAAGAATTTATTAAAGAGAAAGTGTTTGCCAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446171	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61846	(Get FASTA)	NCBI Sequence Viewer
	CAA08796	(Get FASTA)	NCBI Sequence Viewer
	EDM10400	(Get FASTA)	NCBI Sequence Viewer
	O88775	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446171 ⟸ NM_053719
- Peptide Label:	precursor
- UniProtKB:	O88775 (UniProtKB/Swiss-Prot), A6I5U2 (UniProtKB/TrEMBL), A0A0G2JWP4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRSHTGLRALVAPGCSLLLLYLLAATRPDRAVGDPADSAFTSLPVREEMMAKYANLSLETYNIS LTEQTRVSEQNITLERPSHLELECTFTATEDVMSMNVTWKKDDALLETTDGFNTTKMGDTLYSQ YRFTVFNSKQMGKYSCFLGEELRGTFNIRVPKVHGKNKPLITYVGDSTVLKCECQNCLPLNWTW YMSNGTAQVPIDVHVNDKFDINGSYANETKLKVKHLLEEDGGSYWCRAAFPLGESEEHIKLVVL SFMVPLKPFLAIIAEVILLVAIILLCEVYTQKKKNDPDDGKEFEQIEQLKSDDSNGIENNVPRY RKTDSGDQ hide sequence

RefSeq Acc Id:

ENSRNOP00000069959 ⟸ ENSRNOT00000085576

RefSeq Acc Id:

ENSRNOP00000069012 ⟸ ENSRNOT00000079907

RefSeq Acc Id:

ENSRNOP00000078563 ⟸ ENSRNOT00000108249

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88775-F1-model_v2	AlphaFold	O88775	1-328	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621067	AgrOrtholog
BioCyc Gene	G2FUF-54306	BioCyc
Ensembl Genes	ENSRNOG00000060329	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000069012.1	UniProtKB/TrEMBL
	ENSRNOP00000069959	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOP00000078563.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000079907.2	UniProtKB/TrEMBL
	ENSRNOT00000085576	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOT00000108249.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5621074	IMAGE-MGC_LOAD
InterPro	Basigin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_I-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114511	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72351	IMAGE-MGC_LOAD
NCBI Gene	114511	ENTREZGENE
PANTHER	PTHR10075	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10075:SF4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	I-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Emb	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JU92_RAT	UniProtKB/TrEMBL
	A0A0G2JWP4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G388_RAT	UniProtKB/TrEMBL
	A6I5U2	ENTREZGENE, UniProtKB/TrEMBL
	EMB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Emb	embigin	Emb	embigin homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-12-15	Emb	embigin homolog (mouse)	Emb	embigin	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Emb	embigin			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Emb	embigin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	increased expression is correlated with the appearance of highly organized lumenal and ductal structures in the developing prostate gland	632509
gene_product	member of the immunoglobulin superfamily (IgSF) class of cell adhesion molecules	632509

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD