Qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1) Rattus norvegicus

Analyze

Symbol:

Qtrt1

Name:

queuine tRNA-ribosyltransferase catalytic subunit 1

RGD ID:

620996

Description:

Predicted to enable protein heterodimerization activity; protein homodimerization activity; and tRNA-guanosine(34) queuine transglycosylase activity. Predicted to be involved in tRNA-guanine transglycosylation. Predicted to be located in cytoplasm and nucleus. Predicted to be part of transferase complex. Predicted to colocalize with mitochondrion. Orthologous to human QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

guanine insertion enzyme; queuine tRNA-ribosyltransferase; queuine tRNA-ribosyltransferase 1; queuine tRNA-ribosyltransferase catalytic subunit; Tgt; Tgut; tRNA-guanine transglycosylase

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	19,965,801 - 19,973,843 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,966,336 - 19,973,837 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,998,272 - 24,005,546 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,296,109 - 22,303,383 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,196,232 - 20,203,503 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,447,057 - 22,454,328 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,446,661 - 22,454,439 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,501,169 - 22,508,440 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,515,248 - 20,522,519 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	20,515,261 - 20,522,225 (+)	NCBI
Celera	8	21,357,791 - 21,365,062 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

finasteride (EXP)

gentamycin (EXP)

inulin (ISO)

ivermectin (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

resveratrol (ISO)

rotenone (EXP)

selenium atom (ISO)

sodium dichromate (EXP)

sulindac (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

queuosine biosynthetic process (TAS)

tRNA-guanine transglycosylation (IBA,IEA,ISO)

Cellular Component

cytoplasm (ISO)

mitochondrial outer membrane (IEA)

mitochondrion (ISO)

nucleus (IEA,ISO)

protein-containing complex (ISO)

transferase complex (IEA,ISO)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

protein heterodimerization activity (IEA,ISO,ISS)

protein homodimerization activity (IEA,ISO,ISS)

tRNA-guanosine(34) queuine transglycosylase activity (IBA,IEA,ISO,ISS,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Transfer ribonucleic acid guanine transglycosylase isolated from rat liver.	Shindo-Okada N, etal., Biochemistry 1980 Jan 22;19(2):395-400.

Additional References at PubMed

PMID:12477932	PMID:19414587	PMID:20354154

Genomics

Comparative Map Data

Qtrt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	19,965,801 - 19,973,843 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,966,336 - 19,973,837 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,998,272 - 24,005,546 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,296,109 - 22,303,383 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,196,232 - 20,203,503 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,447,057 - 22,454,328 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,446,661 - 22,454,439 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,501,169 - 22,508,440 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,515,248 - 20,522,519 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	20,515,261 - 20,522,225 (+)	NCBI
Celera	8	21,357,791 - 21,365,062 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

QTRT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,701,439 - 10,713,365 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,701,430 - 10,713,437 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,812,115 - 10,824,041 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,673,131 - 10,685,040 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	10,673,130 - 10,685,040	NCBI
Celera	19	10,706,867 - 10,718,794 (+)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,389,232 - 10,401,116 (+)	NCBI		HuRef
CHM1_1	19	10,813,359 - 10,825,254 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,827,905 - 10,839,826 (+)	NCBI		T2T-CHM13v2.0

Qtrt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	21,323,096 - 21,331,575 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	21,323,133 - 21,331,570 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	21,411,801 - 21,420,279 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	21,411,837 - 21,420,274 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	21,216,281 - 21,224,723 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	21,162,305 - 21,170,590 (+)	NCBI		MGSCv36	mm8
Celera	9	18,680,513 - 18,688,894 (+)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI
cM Map	9	7.79	NCBI

Qtrt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	1,851,995 - 1,857,527 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	1,851,861 - 1,857,599 (+)	NCBI	ChiLan1.0	ChiLan1.0

QTRT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	19	14,620,632 - 14,636,228 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	10,255,479 - 10,267,367 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	10,916,336 - 10,928,899 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	10,916,330 - 10,928,899 (+)	Ensembl	panpan1.1		panPan2

QTRT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,489,550 - 50,497,224 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,489,598 - 50,497,165 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	50,361,375 - 50,369,868 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	51,011,297 - 51,019,784 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	50,919,081 - 51,019,741 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	50,219,839 - 50,228,333 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	50,647,166 - 50,655,663 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	50,888,209 - 50,896,703 (-)	NCBI		UU_Cfam_GSD_1.0

Qtrt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	209,400,754 - 209,408,395 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	946,142 - 956,442 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936659	946,338 - 953,952 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

QTRT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,450,808 - 69,471,487 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,450,792 - 69,471,487 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	69,835,087 - 69,855,936 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

QTRT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	9,704,002 - 9,709,990 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	9,704,037 - 9,710,071 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	10,239,693 - 10,266,939 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Qtrt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	2,719,456 - 2,725,517 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	2,719,810 - 2,724,521 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Qtrt1
35 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	60
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000010030
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	24597739	Rat
2317882	Alcrsp24	Alcohol response QTL 24	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	8	1	25902202	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat

Markers in Region

RH141799

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	19,973,628 - 19,973,815 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,454,119 - 22,454,305	NCBI	Rnor6.0
Rnor_5.0	8	22,508,231 - 22,508,417	UniSTS	Rnor5.0
RGSC_v3.4	8	20,522,310 - 20,522,496	UniSTS	RGSC3.4
Celera	8	21,364,853 - 21,365,039	UniSTS
RH 3.4 Map	8	181.1	UniSTS
Cytogenetic Map	8	q13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			6	6	2	6			38	8	18
Low	3	43	51	35	17	35	8	11	36	27	23	11	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB034634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC130555	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010030 ⟹ ENSRNOP00000010030

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,966,336 - 19,973,837 (+)	Ensembl
Rnor_6.0 Ensembl	8	22,446,661 - 22,454,439 (+)	Ensembl

RefSeq Acc Id:

NM_022250 ⟹ NP_071586

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	19,966,567 - 19,973,838 (+)	NCBI
Rnor_6.0	8	22,447,057 - 22,454,328 (+)	NCBI
Rnor_5.0	8	22,501,169 - 22,508,440 (+)	NCBI
RGSC_v3.4	8	20,515,248 - 20,522,519 (+)	RGD
Celera	8	21,357,791 - 21,365,062 (+)	RGD

Sequence:

show sequence

CCGGAACTGAAAATGGCGGCGGTAGGCAGCCCAGGTTCGCTTGAGTCCGCTCCACGAATCATGC
GGCTAGTCGCTGAGTGCAGTCGCTCCAGAGCTCGGGCCGGTGAGCTGCGGCTGCCGCATGGAAC
GGTAGCCACCCCTGTGTTCATGCCTGTGGGTACACAGGCCACCATGAAGGGTATCACCGCGGAG
CAGCTGGACTCCCTGGGCTGCCGCATCTGCTTGGGCAACACCTACCATCTGGGGTTGAGGCCGG
GTCCGGAGCTGATCCAGAAAGCTCACGGTCTTCACGGTTTCATGAATTGGCCCCACAATCTGCT
GACGGATAGCGGCGGCTTCCAGATGGTGTCTCTCATCTCCTTGTCCGAGGTGACGGAGGAGGGC
GTCCGCTTCCGCTCGCCCTATGATGGAGAAGAGACACTTTTGAGCCCAGAGAGGTCGGTGGAGA
TCCAGAACGCTCTGGGCTCGGACATCATCATGCAGTTGGACGATGTGGTGAGCAGCACGGTGAC
AGGCCCTCGAGTGGAGGAGGCCATGCACAGGTCAGTCCGCTGGCTGGACAGATGCATCGCAGCC
CATAAGCGTCAGGACAAGCAGAACCTCTTTGCCATCATCCAGGGCGGACTGAATGCTGATCTTC
GGACCACTTGCCTGAAAGAGATGACCAAGAGGGATGTGCCGGGCTTTGCCATCGGAGGTCTGAG
CGGAGGAGAGAGCAAGGAGCAGTTCTGGAAGATGGTGGCATTGAGCACCTCCATGCTGCCTAAG
GACAAGCCACGCTACCTGATGGGGGTTGGCTATGCCACCGATTTGGTGGTCTGCGTGGCCCTTG
GATGTGACATGTTCGACTGTGTATACCCCACACGGACAGCGCGTTTTGGATCCGCCCTTGTGCC
CACTGGGAACCTGCAGTTGAAGAAGCAGCAGTACGCCAAGGACTTCAGCCCCATAAACCCCGAG
TGTCCCTGTGCCACCTGCCAGACGCACAGCCGCGCCTTCTTGCACACCCTGCTGCACAGTGACA
ACACCGCAGCGCTGCACCACCTCACCGTGCACAACATTGCCTATCAGCTGCAGCTCCTGAGCGC
CGCGCGCAGCAGTATCTTGGAACAGCGCTTTCCCGACTTCGTGCGGAACTTCATGCGGACCATG
TATGGGGACCACAGCCTCTGTCCTGCCTGGGCCATTGAAGCACTGGCCTCTGTGGGAATCACAC
TCACATGACCTGGTTGCTGGGGAAGGACGCTGGGGTACAGGGAATATTGAAGGACTCTTTTTTA
CAAAAGATTTTGTTACTACTTTTTGTTTTCATTTAAGATCTTGTATCTTTTAAGATCTCCCTGT
CTTCTTTCTTCCTCATTGTAGTTGGATTTCTCGATTCTCGGTAAGAAGTAAACCAGAGAGTGGA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082069 ⟹ XP_038937997

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	19,965,830 - 19,973,843 (+)	NCBI

RefSeq Acc Id:

XM_039082070 ⟹ XP_038937998

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	19,966,531 - 19,973,843 (+)	NCBI

RefSeq Acc Id:

XR_005487914

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	19,965,801 - 19,972,852 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071586	(Get FASTA)	NCBI Sequence Viewer
	XP_038937997	(Get FASTA)	NCBI Sequence Viewer
	XP_038937998	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97321	(Get FASTA)	NCBI Sequence Viewer
	BAA93552	(Get FASTA)	NCBI Sequence Viewer
	EDL78295	(Get FASTA)	NCBI Sequence Viewer
	EDL78296	(Get FASTA)	NCBI Sequence Viewer
	EDL78297	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010030
	ENSRNOP00000010030.6
GenBank Protein	Q4QR99	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071586 ⟸ NM_022250

- UniProtKB:

Q9JMA0 (UniProtKB/Swiss-Prot), Q4QR99 (UniProtKB/Swiss-Prot), A0A0H2UHF3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAVGSPGSLESAPRIMRLVAECSRSRARAGELRLPHGTVATPVFMPVGTQATMKGITAEQLDS
LGCRICLGNTYHLGLRPGPELIQKAHGLHGFMNWPHNLLTDSGGFQMVSLISLSEVTEEGVRFR
SPYDGEETLLSPERSVEIQNALGSDIIMQLDDVVSSTVTGPRVEEAMHRSVRWLDRCIAAHKRQ
DKQNLFAIIQGGLNADLRTTCLKEMTKRDVPGFAIGGLSGGESKEQFWKMVALSTSMLPKDKPR
YLMGVGYATDLVVCVALGCDMFDCVYPTRTARFGSALVPTGNLQLKKQQYAKDFSPINPECPCA
TCQTHSRAFLHTLLHSDNTAALHHLTVHNIAYQLQLLSAARSSILEQRFPDFVRNFMRTMYGDH
SLCPAWAIEALASVGITLT

hide sequence

RefSeq Acc Id:

ENSRNOP00000010030 ⟸ ENSRNOT00000010030

RefSeq Acc Id:	XP_038937997 ⟸ XM_039082069
- Peptide Label:	isoform X1
- UniProtKB:	A0A0H2UHF3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038937998 ⟸ XM_039082070
- Peptide Label:	isoform X2

Protein Domains

tRNA-guanine(15) transglycosylase-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QR99-F1-model_v2	AlphaFold	Q4QR99	1-403	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620996	AgrOrtholog
BioCyc Gene	G2FUF-31420	BioCyc
BioCyc Pathway	PWY-8105 [queuosine biosynthesis II (queuine salvage)]	BioCyc
Ensembl Genes	ENSRNOG00000007158	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010030	ENTREZGENE
	ENSRNOT00000010030.7	UniProtKB/TrEMBL
Gene3D-CATH	3.20.20.105	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7387393	IMAGE-MGC_LOAD
InterPro	TGT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGT-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	tRNA_ribo_trans-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64016	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114324	IMAGE-MGC_LOAD
NCBI Gene	64016	ENTREZGENE
PANTHER	QUEUINE TRNA-RIBOSYLTRANSFERASE CATALYTIC SUBUNIT 1	UniProtKB/Swiss-Prot
	QUEUINE TRNA-RIBOSYLTRANSFERASE CATALYTIC SUBUNIT 1	UniProtKB/Swiss-Prot
	QUEUINE TRNA-RIBOSYLTRANSFERASE CATALYTIC SUBUNIT 1	UniProtKB/TrEMBL
	QUEUINE TRNA-RIBOSYLTRANSFERASE CATALYTIC SUBUNIT 1	UniProtKB/TrEMBL
Pfam	TGT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Qtrt1	PhenoGen
RatGTEx	ENSRNOG00000007158	RatGTEx
Superfamily-SCOP	SSF51713	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHF3	ENTREZGENE, UniProtKB/TrEMBL
	A6JNR9_RAT	UniProtKB/TrEMBL
	A6JNS0_RAT	UniProtKB/TrEMBL
	A6JNS1_RAT	UniProtKB/TrEMBL
	Q4QR99	ENTREZGENE
	Q9JMA0	ENTREZGENE
	TGT_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9JMA0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Qtrt1	queuine tRNA-ribosyltransferase catalytic subunit 1	Qtrt1	queuine tRNA-ribosyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Qtrt1	queuine tRNA-ribosyltransferase 1	Tgt	tRNA-guanine transglycosylase	Symbol and Name updated	1299863	APPROVED
2002-08-07	Tgt	tRNA-guanine transglycosylase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in liver	724772

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar