Opn1mw (opsin 1, medium wave sensitive)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Opn1mw (opsin 1, medium wave sensitive) Rattus norvegicus

Analyze

Symbol:

Opn1mw

Name:

opsin 1, medium wave sensitive

RGD ID:

620978

Description:

Predicted to enable identical protein binding activity and photoreceptor activity. Predicted to be involved in positive regulation of cytokinesis. Located in photoreceptor outer segment. Human ortholog(s) of this gene implicated in blue cone monochromacy; red color blindness; and red-green color blindness. Orthologous to several human genes including OPN1LW (opsin 1, long wave sensitive) and OPN1MW (opsin 1, medium wave sensitive); PARTICIPATES IN retinoid cycle metabolic pathway; visual phototransduction pathway; INTERACTS WITH 17alpha-ethynylestradiol; ammonium chloride; monosodium L-glutamate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

green cone photoreceptor pigment; green-sensitive opsin; medium wavelength-sensitive cone opsin; medium-wave-sensitive opsin 1; opsin 1 (cone pigments), medium-wave-sensitive; opsin 1 (cone pigments), medium-wave-sensitive (color blindness, deutan); opsin 1 (cone pigments), medium-wave-sensitive (color blindness, deutan), green opsin

RGD Orthologs

Human

Mouse

Pig

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	X	151,905,056 - 151,925,419 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	151,905,096 - 151,925,388 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	154,046,219 - 154,066,443 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	157,609,455 - 157,629,679 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	155,281,257 - 155,301,483 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	156,569,683 - 156,589,907 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	156,569,683 - 156,589,907 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	152,310,261 - 152,330,485 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	160,095,742 - 160,115,966 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	160,171,359 - 160,191,584 (+)	NCBI
Celera	1	135,969,802 - 135,990,029 (-)	NCBI		Celera
Cytogenetic Map	X	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

achromatopsia (ISO)

adrenoleukodystrophy (ISO)

autistic disorder (ISO)

Barth syndrome (ISO)

blue cone monochromacy (ISO,ISS)

cerebral creatine deficiency syndrome 1 (ISO)

dyskeratosis congenita (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

favism (ISO)

frontometaphyseal dysplasia (ISO)

genetic disease (ISO)

immunodeficiency 33 (ISO)

Juberg Hayward Syndrome (ISO)

Melnick-Needles syndrome (ISO)

methylmalonic acidemia and homocysteinemia cblX type (ISO)

otopalatodigital syndrome type 2 (ISO)

paraplegia (ISO)

periventricular nodular heterotopia (ISO)

Periventricular Nodular Heterotopia 4 (ISO)

red-green color blindness (ISO)

severe congenital encephalopathy due to MECP2 mutation (ISO)

Splenomegaly (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2-hydroxypropanoic acid (ISO)

ammonium chloride (EXP)

dextran sulfate (ISO)

folic acid (ISO)

monosodium L-glutamate (EXP)

rac-lactic acid (ISO)

silver atom (ISO)

silver(0) (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to light stimulus (IBA)

detection of visible light (IEA)

G protein-coupled receptor signaling pathway (IBA,IEA)

phototransduction (IBA,IEA)

positive regulation of cytokinesis (ISO)

visual perception (IEA)

Cellular Component

membrane (IEA)

photoreceptor outer segment (IBA,IDA,ISO)

plasma membrane (ISO,ISS)

Molecular Function

G protein-coupled photoreceptor activity (IBA)

G protein-coupled receptor activity (IEA)

identical protein binding (ISO,ISS)

photoreceptor activity (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

retinoid cycle metabolic pathway (ISO)

visual phototransduction pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	CNTF induces regeneration of cone outer segments in a rat model of retinal degeneration.	Li Y, etal., PLoS One. 2010 Mar 2;5(3):e9495.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
7.	Genetic analyses of the green visual pigments of rabbit (Oryctolagus cuniculus) and rat (Rattus norvegicus).	Radlwimmer FB and Yokoyama S, Gene 1998 Sep 18;218(1-2):103-9.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Membrane receptors and transporters involved in the function and transport of vitamin A and its derivatives.	Sun H Biochim Biophys Acta. 2012 Jan;1821(1):99-112. Epub 2011 Jun 17.
13.	The "five-sites" rule and the evolution of red and green color vision in mammals.	Yokoyama S and Radlwimmer FB, Mol Biol Evol 1998 May;15(5):560-7.

Additional References at PubMed

PMID:8185948	PMID:10725384	PMID:12651948	PMID:19332056	PMID:20371244	PMID:20579627	PMID:22888021	PMID:23351594	PMID:23386608	PMID:28402104

Genomics

Comparative Map Data

Opn1mw
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	X	151,905,056 - 151,925,419 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	151,905,096 - 151,925,388 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	154,046,219 - 154,066,443 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	157,609,455 - 157,629,679 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	155,281,257 - 155,301,483 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	156,569,683 - 156,589,907 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	156,569,683 - 156,589,907 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	152,310,261 - 152,330,485 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	160,095,742 - 160,115,966 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	160,171,359 - 160,191,584 (+)	NCBI
Celera	1	135,969,802 - 135,990,029 (-)	NCBI		Celera
Cytogenetic Map	X	q37	NCBI

OPN1MW
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	154,182,596 - 154,196,861 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	154,182,596 - 154,196,861 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	153,448,085 - 153,462,352 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	153,101,361 - 153,114,725 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	153,006,131 - 153,019,496	NCBI
Celera	X	153,643,424 - 153,658,069 (+)	NCBI		Celera
Cytogenetic Map	X	q28	NCBI
CHM1_1	X	153,322,583 - 153,336,848 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	152,456,258 - 152,470,523 (+)	NCBI		T2T-CHM13v2.0

Opn1mw
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	73,171,072 - 73,194,362 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	73,171,070 - 73,194,366 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	74,127,466 - 74,150,756 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	74,127,464 - 74,150,760 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	71,372,805 - 71,396,095 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	70,380,186 - 70,403,476 (+)	NCBI		MGSCv36	mm8
Celera	X	65,379,870 - 65,403,149 (+)	NCBI		Celera
Cytogenetic Map	X	A7.3	NCBI

LOC494564
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	X	124,816,014 - 124,828,225 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Variants

Variants in Opn1mw
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	41
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000056325
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059603	Bw174	Body weight QTL 174	3.4	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	X	113937816	152453651	Rat
634346	Insul4	Insulin level QTL 4	0		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	X	126975089	152453651	Rat

Markers in Region

stSG603914

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	151,913,543 - 151,914,670 (-)	MAPPER	mRatBN7.2
Rnor_6.0	X	156,580,333 - 156,581,459	NCBI	Rnor6.0
Rnor_5.0	1	152,320,911 - 152,322,037	UniSTS	Rnor5.0
RGSC_v3.4	X	160,104,190 - 160,105,316	UniSTS	RGSC3.4
Celera	1	135,980,455 - 135,981,581	UniSTS
Cytogenetic Map	X	q37	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	endocrine system	exocrine system	hepatobiliary system	nervous system	reproductive system
High
Medium
Low
Below cutoff	1	1	1	4	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF031528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH006946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000083147 ⟹ ENSRNOP00000072867

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	151,905,096 - 151,925,322 (+)	Ensembl
Rnor_6.0 Ensembl	X	156,569,683 - 156,589,907 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109312 ⟹ ENSRNOP00000089832

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	151,905,096 - 151,925,388 (+)	Ensembl

RefSeq Acc Id:

NM_053548 ⟹ NP_446000

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	X	151,905,056 - 151,925,419 (+)	NCBI
Rnor_6.0	X	156,569,683 - 156,589,907 (-)	NCBI
Rnor_5.0	1	152,310,261 - 152,330,485 (-)	NCBI
RGSC_v3.4	X	160,095,742 - 160,115,966 (+)	RGD
Celera	1	135,969,802 - 135,990,029 (-)	NCBI

Sequence:

show sequence

ATGGCCCAACAGCTTACAGGTGAACAGACACTGGACCATTATGAGGATAGCACCCAGGCAAGCA
TCTTCACCTATACCAACAGCAACAGCACCAGAGGTCCCTTTGAAGGTCCCAATTATCACATTGC
TCCAAGGTGGGTGTACCACCTCACCAGCACCTGGATGATTCTTGTGGTCATTGCATCTGTCTTC
ACAAATGGACTCGTGCTGGCAGCCACCATGAGGTTCAAGAAGCTGCGTCATCCTCTGAACTGGA
TTCTAGTGAACTTGGCAGTTGCTGACCTAGCAGAGACCATTATTGCCAGCACTATCAGTGTTGT
GAACCAAATCTATGGCTACTTTGTGCTGGGCCACCCTCTGTGTGTCATAGAAGGCTACATTGTC
TCACTATGTGGGATCACAGGCCTCTGGTCCTTGGCCATCATTTCCTGGGAGAGATGGCTGGTGG
TCTGCAAGCCCTTTGGCAATGTGAGATTTGATGCTAAACTGGCCACTGTGGGAATCGTCTTCTC
CTGGGTCTGGGCTGCTGTATGGACGGCCCCACCAATCTTTGGTTGGAGCAGGTACTGGCCTTAT
GGCCTGAAGACATCGTGTGGTCCAGACGTGTTCAGCGGTACCTCGTATCCTGGGGTTCAGTCTT
ATATGATGGTCCTCATGGTCACGTGCTGCATCTTCCCACTCAGCATCATCGTGCTCTGCTACCT
CCAAGTGTGGCTGGCCATCCGAGCAGTGGCAAAGCAACAGAAAGAATCTGAGTCCACCCAGAAG
GCTGAGAAGGAGGTGACACGCATGGTGGTGGTGATGGTCTTCGCATACTGCCTCTGCTGGGGGC
CCTATACTTTCTTTGCATGCTTTGCTACTGCCCATCCTGGCTATGCCTTCCACCCTCTTGTGGC
CTCCCTACCATCCTACTTTGCCAAAAGTGCCACTATCTACAATCCCATTATCTATGTCTTTATG
AACCGGCAGTTTCGAAATTGCATCTTACAGCTCTTTGGAAAGAAAGTTGATGATAGCTCTGAAC
TTTCCAGCACCTCCAAAACAGAAGTCTCATCTGTCTCTTCAGTGTCACCTGCATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446000	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB86946	(Get FASTA)	NCBI Sequence Viewer
	AAC64920	(Get FASTA)	NCBI Sequence Viewer
	EDL84994	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072867
	ENSRNOP00000089832.1
GenBank Protein	O35476	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446000 ⟸ NM_053548

- UniProtKB:

O35476 (UniProtKB/Swiss-Prot), A6KRS8 (UniProtKB/TrEMBL), A0A8I6ACH6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAQQLTGEQTLDHYEDSTQASIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSTWMILVVIASVF
TNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPLCVIEGYIV
SLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAVWTAPPIFGWSRYWPY
GLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLAIRAVAKQQKESESTQK
AEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYAFHPLVASLPSYFAKSATIYNPIIYVFM
NRQFRNCILQLFGKKVDDSSELSSTSKTEVSSVSSVSPA

hide sequence

RefSeq Acc Id:

ENSRNOP00000072867 ⟸ ENSRNOT00000083147

RefSeq Acc Id:

ENSRNOP00000089832 ⟸ ENSRNOT00000109312

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35476-F1-model_v2	AlphaFold	O35476	1-359	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620978	AgrOrtholog
BioCyc Gene	G2FUF-641	BioCyc
Ensembl Genes	ENSRNOG00000051529	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000083147	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000109312.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Opsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Opsin_red/grn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Retinal_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:89810	UniProtKB/Swiss-Prot
NCBI Gene	89810	ENTREZGENE
PANTHER	MEDIUM-WAVE-SENSITIVE OPSIN 1-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Opn1mw	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSINREDGRN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000051529	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6ACH6	ENTREZGENE, UniProtKB/TrEMBL
	A6KRS8	ENTREZGENE, UniProtKB/TrEMBL
	O35476	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-02-12	Opn1mw	opsin 1, medium wave sensitive	Opn1mw	opsin 1 (cone pigments), medium-wave-sensitive	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Opn1mw	opsin 1 (cone pigments), medium-wave-sensitive	Opn1mw	opsin 1 (cone pigments), medium-wave-sensitive (color blindness, deutan)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Opn1mw	opsin 1 (cone pigments), medium-wave-sensitive (color blindness, deutan)		opsin 1 (cone pigments), medium-wave-sensitive (color blindness, deutan), green opsin	Name updated	1299863	APPROVED
2002-08-07	Opn1mw	opsin 1 (cone pigments), medium-wave-sensitive (color blindness, deutan), green opsin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_other	has a wavelength of maximal absorption (lambdamax) of 509nm	729211

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations