Tnmd (tenomodulin) - Rat Genome Database

Name: Tnmd
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Tnmd (tenomodulin) Rattus norvegicus

Analyze

Symbol:

Tnmd

Name:

tenomodulin

RGD ID:

620938

Description:

Involved in cellular response to BMP stimulus and tendon cell differentiation. Predicted to be located in membrane and nuclear envelope. Orthologous to human TNMD (tenomodulin); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 2,3,7,8-Tetrachlorodibenzofuran; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ChM1L; chondromodulin-1-like protein; chondromodulin-I-like protein; myodulin; rChM1L; rTeM; teM

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TNMD (tenomodulin)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Tnmd (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tnmd (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TNMD (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TNMD (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tnmd (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TNMD (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TNMD (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tnmd (tenomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TNMD (tenomodulin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Tnmd (tenomodulin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tnmd (tenomodulin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	101,350,432 - 101,365,929 (+)	NCBI		GRCr8
mRatBN7.2	X	97,057,137 - 97,072,634 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	97,057,137 - 97,072,634 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	98,731,282 - 98,746,779 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	102,241,064 - 102,256,561 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	99,744,458 - 99,759,955 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	104,684,676 - 104,700,173 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	104,684,676 - 104,700,173 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	104,520,020 - 104,535,506 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	121,396,741 - 121,412,196 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	121,470,173 - 121,485,630 (+)	NCBI
Celera	X	98,105,001 - 98,120,498 (+)	NCBI		Celera
Cytogenetic Map	X	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

developmental and epileptic encephalopathy 9 (ISO)

genetic disease (ISO)

isolated growth hormone deficiency type III (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4-nitrophenol (ISO)

7,12-dimethyltetraphene (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

carbamazepine (ISO)

dibutyl phthalate (ISO)

dorsomorphin (ISO)

entinostat (ISO)

paracetamol (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

trichloroethene (EXP)

triclosan (ISO)

undecane (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to BMP stimulus (IEP)

endothelial cell morphogenesis (IEA,ISO)

negative regulation of angiogenesis (IBA,IEA,ISO)

negative regulation of endothelial cell proliferation (IBA,IEA,ISO)

tendon cell differentiation (IEP)

Cellular Component

cell surface (NAS)

membrane (IEA)

nuclear envelope (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	BMP-12 treatment of adult mesenchymal stem cells in vitro augments tendon-like tissue formation and defect repair in vivo.	Lee JY, etal., PLoS One. 2011 Mar 11;6(3):e17531. doi: 10.1371/journal.pone.0017531.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Molecular cloning and characterization of CHM1L, a novel membrane molecule similar to chondromodulin-I.	Yamana K, etal., Biochem Biophys Res Commun 2001 Feb 2;280(4):1101-6.

Additional References at PubMed

PMID:12714610	PMID:14720505	PMID:18337200	PMID:28750046	PMID:30307981	PMID:34066472	PMID:36513131

Genomics

Comparative Map Data

Tnmd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	101,350,432 - 101,365,929 (+)	NCBI		GRCr8
mRatBN7.2	X	97,057,137 - 97,072,634 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	97,057,137 - 97,072,634 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	98,731,282 - 98,746,779 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	102,241,064 - 102,256,561 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	99,744,458 - 99,759,955 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	104,684,676 - 104,700,173 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	104,684,676 - 104,700,173 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	104,520,020 - 104,535,506 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	121,396,741 - 121,412,196 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	121,470,173 - 121,485,630 (+)	NCBI
Celera	X	98,105,001 - 98,120,498 (+)	NCBI		Celera
Cytogenetic Map	X	q32	NCBI

TNMD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	100,584,936 - 100,599,885 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	100,584,936 - 100,599,885 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	99,839,933 - 99,854,882 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	99,726,446 - 99,741,538 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	99,645,974 - 99,661,022	NCBI
Celera	X	100,358,526 - 100,373,618 (+)	NCBI		Celera
Cytogenetic Map	X	q22.1	NCBI
HuRef	X	89,639,690 - 89,654,782 (+)	NCBI		HuRef
CHM1_1	X	99,732,699 - 99,747,791 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	99,027,366 - 99,042,315 (+)	NCBI		T2T-CHM13v2.0

Tnmd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	132,751,757 - 132,766,326 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	132,751,729 - 132,766,326 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	133,851,008 - 133,865,577 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	133,850,980 - 133,865,577 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	130,385,547 - 130,400,116 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	129,197,358 - 129,211,927 (+)	NCBI		MGSCv36	mm8
Celera	X	116,728,599 - 116,743,105 (+)	NCBI		Celera
Cytogenetic Map	X	E3	NCBI
cM Map	X	55.47	NCBI

Tnmd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955503	6,732,733 - 6,750,717 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955503	6,732,791 - 6,750,693 (+)	NCBI	ChiLan1.0	ChiLan1.0

TNMD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	100,192,706 - 100,208,094 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	100,205,018 - 100,211,699 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	89,795,752 - 89,810,791 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	99,935,207 - 99,950,283 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	99,935,207 - 99,950,283 (+)	Ensembl	panpan1.1		panPan2

TNMD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	74,459,111 - 74,475,010 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	74,459,313 - 74,478,170 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	X	75,868,805 - 75,884,657 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	75,868,965 - 75,884,664 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	73,431,133 - 73,446,983 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	75,101,495 - 75,117,351 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	74,862,398 - 74,878,257 (+)	NCBI		UU_Cfam_GSD_1.0

Tnmd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	63,734,330 - 63,749,631 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936584	5,803,309 - 5,818,647 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936584	5,803,309 - 5,818,643 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNMD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	82,269,239 - 82,292,246 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	82,269,323 - 82,292,083 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	90,109,157 - 90,132,534 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNMD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	88,895,412 - 88,911,679 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	88,896,106 - 88,911,699 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	13,825,083 - 13,840,866 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnmd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624902	2,019,185 - 2,038,311 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624902	2,019,649 - 2,038,203 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tnmd
26 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	141
Count of miRNA genes:	111
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000005214
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat
738035	Stresp1	Stress response QTL 1	4.96	0.000011	stress-related behavior trait (VT:0010451)	defensive burying - coping	X	41304447	112935181	Rat
61431	Cia19	Collagen induced arthritis QTL 19	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	65612192	120568734	Rat
724551	Glom1	Glomerulus QTL 1	2.8	0.0004	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	X	75294106	120294106	Rat
1598872	Memor14	Memory QTL 14	4.5		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	93956491	138956491	Rat

Markers in Region

RH132574

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	97,072,385 - 97,072,572 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	104,699,925 - 104,700,111	NCBI	Rnor6.0
Rnor_5.0	X	104,535,269 - 104,535,455	UniSTS	Rnor5.0
RGSC_v3.4	X	121,411,990 - 121,412,176	UniSTS	RGSC3.4
Celera	X	98,120,250 - 98,120,436	UniSTS
Cytogenetic Map	X	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium							6	7					6
Low	1	8	12		18		2	4	23	26	17	10	2
Below cutoff	1	19	9	5	1	5			35	9	17	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB055423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF191769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000083229 ⟹ ENSRNOP00000073972

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	97,057,137 - 97,072,634 (+)	Ensembl
Rnor_6.0 Ensembl	X	104,684,676 - 104,700,173 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106427 ⟹ ENSRNOP00000076479

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	97,057,354 - 97,072,634 (+)	Ensembl

RefSeq Acc Id:

NM_022290 ⟹ NP_071626

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	101,350,432 - 101,365,929 (+)	NCBI
mRatBN7.2	X	97,057,137 - 97,072,634 (+)	NCBI
Rnor_6.0	X	104,684,676 - 104,700,173 (+)	NCBI
Rnor_5.0	X	104,520,020 - 104,535,506 (+)	NCBI
RGSC_v3.4	X	121,396,741 - 121,412,196 (+)	RGD
Celera	X	98,105,001 - 98,120,498 (+)	RGD

Sequence:

show sequence

TGTGCACAGAAGTTATATACATATATGGGTATATCTATGTAACAAATCGTAGCACGGGAGCCCC
CTGGGCTCCCTCCGGCTCTGGTATGACATATTTGAGCCATATAAATTCAGCTTCTCCTCTGGCA
TCTGTTAGCCGACTCACTTGCAACTCCACCTCAGCAGTGGTCTCTCAGTCCTCTCAAAGCAAGG
AAAGAGCACTGTGTGCTGGGAGACCATGGCAAAGAATCCTCCAGAGAACTGTGAGGGCTGTCAC
ATTCTAAATGCAGAAGCTCTGAAATCTAAGAAGATACGTAAATCACTGAAGATTTGTGGACTAG
TGTTTGGTATCCTGGCCTTAACTCTAATTGTCCTGTTTTGGGGGAGCAAACACTTCTGGCCCGA
GGTATCCAAGAAGACCTATGGCATGGAGCACACTTTCTACAGCAATGGCGAGAAGAAGAAGATT
TCCATGGAAATTGATCCCATAACCAGAACAGAAATATTCAGAAGTGGAAATGGCACCGATGAAA
CATTGGAAGTCCATGACTTTAAAAACGGATACACTGGCATCTACTTTGTAGGTCTTCAAAAATG
CTTTATTAAAACTCAAATCAAAGTGATTCCTGAATTTTCTGAACCAGAAGAGGAAATAGATGAG
AATGAAGAAATTACTACAACGTTCTTTGAACAGTCAGTGATTTGGGTTCCTGCAGAAAAGCCTA
TTGAAAACAGAGACTTCCTGAAAAATTCTAAAATTCTGGAGATTTGCGACAATGTGACTATGTA
CTGGATCAATCCCACTCTAATAGCAGTTTCAGAATTACAGGACTTTGAGGAGGATGGTGAAGAT
CTTCACTTTCCTACCAGCGAAAAAAAAGGGATTGACCAGAATGAGCAATGGGTGGTCCCACAAG
TGAAGGTGGAGAAGACCCGCCGCACCAGACAAGCAAGCGAGGAAGACCTTCCTGTTAATGACTA
TACTGAAAATGGAATCGAATTTGATCCCATGCTGGATGAGAGAGGTTACTGTTGTATTTACTGC
CGTCGAGGCAACCGCTACTGCCGCAGGGTCTGTGAACCTTTACTAGGCTACTACCCATACCCCT
ACTGCTACCAAGGAGGTCGAGTCATCTGTCGTGTCATCATGCCTTGCAACTGGTGGGTGGCCCG
CATGCTTGGGAGAGTCTAATAGGAAGTTTGAGTCCAAATGCTTAACCTTTTGTTAGCCAACATA
TAATTAATGCATGCTACTCCATGAATTTCTGCATTTGCCTCCAAGTAGCCTATCCTCCAGAATT
ATTTGTAGGATATTCCTCTCTTCGTGTTCTAATAAACGTCTACATCATCATCAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071626	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG28394	(Get FASTA)	NCBI Sequence Viewer
	BAB21758	(Get FASTA)	NCBI Sequence Viewer
	EDM07043	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073972
	ENSRNOP00000073972.1
	ENSRNOP00000076479.1
	ENSRNOP00055020229
	ENSRNOP00060026831
	ENSRNOP00065006832
GenBank Protein	Q9ESC2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071626 ⟸ NM_022290

- UniProtKB:

Q9ESC2 (UniProtKB/Swiss-Prot), A6IVD7 (UniProtKB/TrEMBL), A0A8I5Y566 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAKNPPENCEGCHILNAEALKSKKIRKSLKICGLVFGILALTLIVLFWGSKHFWPEVSKKTYGM
EHTFYSNGEKKKISMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKV
IPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIA
VSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRRTRQASEEDLPVNDYTENGIEFD
PMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

hide sequence

RefSeq Acc Id:

ENSRNOP00000073972 ⟸ ENSRNOT00000083229

RefSeq Acc Id:

ENSRNOP00000076479 ⟸ ENSRNOT00000106427

Protein Domains

BRICHOS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ESC2-F1-model_v2	AlphaFold	Q9ESC2	1-317	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620938	AgrOrtholog
BioCyc Gene	G2FUF-1700	BioCyc
Ensembl Genes	ENSRNOG00000060970	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055014413	UniProtKB/Swiss-Prot
	ENSRNOG00060018940	UniProtKB/Swiss-Prot
	ENSRNOG00065006236	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000083229	ENTREZGENE
	ENSRNOT00000083229.2	UniProtKB/Swiss-Prot
	ENSRNOT00000106427.1	UniProtKB/TrEMBL
	ENSRNOT00055024751	UniProtKB/Swiss-Prot
	ENSRNOT00060032832	UniProtKB/Swiss-Prot
	ENSRNOT00065009522	UniProtKB/Swiss-Prot
InterPro	BRICHOS_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chondromodulin/Tenomodulin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64104	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	64104	ENTREZGENE
PANTHER	PTHR14064	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TENOMODULIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	BRICHOS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tnmd	PhenoGen
PROSITE	BRICHOS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000060970	RatGTEx
	ENSRNOG00055014413	RatGTEx
	ENSRNOG00060018940	RatGTEx
	ENSRNOG00065006236	RatGTEx
SMART	BRICHOS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5Y566	ENTREZGENE, UniProtKB/TrEMBL
	A6IVD7	ENTREZGENE, UniProtKB/TrEMBL
	Q9ESC2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Tnmd	tenomodulin			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Tnmd				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to cell surface	727311
gene_expression	mRNA is highly expressed in eye, skeletal muscle, and whole rib	727311
gene_protein	predicted protein contains 317 aa residues, with a non-glycosylated mass of 40 kDa	727311

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar