Advanced Search (OLGA)

Gene: Ppp2r1a (protein phosphatase 2 scaffold subunit A alpha) Rattus norvegicus

Analyze

Symbol:

Ppp2r1a

Name:

protein phosphatase 2 scaffold subunit A alpha

RGD ID:

620907

Description:

Predicted to enable several functions, including protein antigen binding activity; protein heterodimerization activity; and protein phosphatase regulator activity. Predicted to be involved in several processes, including T cell homeostasis; meiotic sister chromatid cohesion, centromeric; and negative regulation of intracellular signal transduction. Predicted to act upstream of or within several processes, including nuclear division; peptidyl-serine dephosphorylation; and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand. Predicted to be located in several cellular components, including chromosome, centromeric region; lateral plasma membrane; and neuronal cell body. Predicted to be part of FAR/SIN/STRIPAK complex and protein phosphatase type 2A complex. Predicted to be active in cytosol; glutamatergic synapse; and nucleus. Human ortholog(s) of this gene implicated in autosomal dominant intellectual developmental disorder 36. Orthologous to human PPP2R1A (protein phosphatase 2 scaffold subunit Aalpha); PARTICIPATES IN phosphatidylinositol 3-kinase-Akt signaling pathway; platelet-derived growth factor signaling pathway; Chagas disease pathway; INTERACTS WITH (R)-adrenaline; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha isoform of regulatory subunit A, protein phosphatase 2; MGC95083; PR65; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform; protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; protein phosphatase 2, regulatory subunit A, alpha; serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	69,213,198 - 69,232,441 (+)	NCBI		GRCr8
mRatBN7.2	1	60,540,223 - 60,559,467 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	60,540,194 - 60,560,129 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	65,329,720 - 65,348,961 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	74,024,287 - 74,043,556 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	67,239,755 - 67,258,997 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	60,717,386 - 60,736,629 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,717,386 - 60,736,609 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	61,883,998 - 61,903,241 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	58,442,220 - 58,461,462 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	58,458,861 - 58,463,770 (+)	NCBI
Celera	1	56,683,597 - 56,702,854 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	autism spectrum disorder		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:25741868
Ppp2r1a	Rat	autosomal dominant intellectual developmental disorder 36		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Houge-Janssens syndrome 2 \| ClinVar Annotator: match by term: INTELLECTUAL more ...	ClinVar	PMID:17576681\|PMID:24728327\|PMID:25533962\|PMID:25741868\|PMID:26168268\|PMID:28492532\|PMID:29100083\|PMID:30755392\|PMID:31531803\|PMID:31687265\|PMID:31785789\|PMID:32901917\|PMID:33106617\|PMID:34930662\|PMID:36209351\|PMID:9536098
Ppp2r1a	Rat	gastric adenocarcinoma		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Adenocarcinoma of stomach \| ClinVar Annotator: match by term: Gastric more ...	ClinVar	PMID:25741868\|PMID:26168268\|PMID:26619011\|PMID:28492532
Ppp2r1a	Rat	gastric adenocarcinoma		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Adenocarcinoma of stomach	ClinVar	PMID:25741868\|PMID:26168268\|PMID:26619011\|PMID:28492532\|PMID:31687265
Ppp2r1a	Rat	genetic disease		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25533962\|PMID:25741868\|PMID:26168268\|PMID:28492532\|PMID:29100083\|PMID:31531803\|PMID:33106617
Ppp2r1a	Rat	head and neck squamous cell carcinoma		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Head and neck squamous cell carcinoma \| ClinVar Annotator: match more ...	ClinVar	PMID:25741868\|PMID:26168268\|PMID:26619011\|PMID:28492532
Ppp2r1a	Rat	head and neck squamous cell carcinoma		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Squamous cell carcinoma of the head and neck	ClinVar	PMID:25741868\|PMID:26168268\|PMID:26619011\|PMID:28492532\|PMID:31687265
Ppp2r1a	Rat	intellectual disability		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:25741868\|PMID:28492532\|PMID:31687265
Ppp2r1a	Rat	Neurodevelopmental Disorders		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Ppp2r1a	Rat	osteogenesis imperfecta		ISO	RGD:1345219	8554872	ClinVar Annotator: match by term: Lobstein disease	ClinVar	PMID:25741868\|PMID:25944380\|PMID:28492532\|PMID:29100083\|PMID:31531803\|PMID:33106617

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	Disease Progression		ISO	RGD:1345219	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21364753
Ppp2r1a	Rat	osteoarthritis		ISO	RGD:1345219	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18784066
Ppp2r1a	Rat	Stomach Neoplasms		ISO	RGD:1345219	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21364753

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	autosomal dominant intellectual developmental disorder 36		ISO	RGD:1345219	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1550262	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPP2R1A mRNA	CTD	PMID:36331819
Ppp2r1a	Rat	(R)-adrenaline	decreases expression	EXP		6480464	Epinephrine results in decreased expression of PPP2R1A protein	CTD	PMID:19464573
Ppp2r1a	Rat	(R)-adrenaline	multiple interactions	EXP		6480464	[Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of PPP2R1A protein	CTD	PMID:19464573
Ppp2r1a	Rat	(Z)-3-butylidenephthalide	increases expression	ISO	RGD:1345219	6480464	butylidenephthalide results in increased expression of PPP2R1A protein	CTD	PMID:23770345
Ppp2r1a	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1550262	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PPP2R1A mRNA]	CTD	PMID:22206623
Ppp2r1a	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1550262	6480464	1,2-Dimethylhydrazine results in increased expression of PPP2R1A mRNA	CTD	PMID:22206623
Ppp2r1a	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1550262	6480464	Ethinyl Estradiol results in increased expression of PPP2R1A mRNA	CTD	PMID:17942748
Ppp2r1a	Rat	17beta-estradiol	increases expression	ISO	RGD:1550262	6480464	Estradiol results in increased expression of PPP2R1A mRNA	CTD	PMID:39298647
Ppp2r1a	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1550262	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of PPP2R1A mRNA	CTD	PMID:30294300
Ppp2r1a	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1550262	6480464	Tetrachlorodibenzodioxin affects the expression of PPP2R1A mRNA	CTD	PMID:21570461
Ppp2r1a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PPP2R1A mRNA	CTD	PMID:34747641
Ppp2r1a	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	decreases expression	EXP		6480464	2,2',4,4',5-brominated diphenyl ether results in decreased expression of PPP2R1A protein	CTD	PMID:19954255
Ppp2r1a	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:1345219	6480464	[Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ...	CTD	PMID:38598786
Ppp2r1a	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of PPP2R1A mRNA	CTD	PMID:21346803
Ppp2r1a	Rat	2-bromohexadecanoic acid	multiple interactions	ISO	RGD:1345219	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Ppp2r1a	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:1550262	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of PPP2R1A mRNA	CTD	PMID:20188158
Ppp2r1a	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1550262	6480464	bisphenol S results in increased expression of PPP2R1A mRNA	CTD	PMID:39298647
Ppp2r1a	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1345219	6480464	bisphenol S results in increased expression of PPP2R1A protein	CTD	PMID:34186270
Ppp2r1a	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2,6-dinitrotoluene affects the expression of PPP2R1A mRNA	CTD	PMID:21346803
Ppp2r1a	Rat	5-aza-2'-deoxycytidine	increases expression	ISO	RGD:1550262	6480464	Decitabine results in increased expression of PPP2R1A mRNA	CTD	PMID:27915011
Ppp2r1a	Rat	7H-xanthine	multiple interactions	EXP		6480464	[Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of PPP2R1A protein	CTD	PMID:19464573
Ppp2r1a	Rat	9H-xanthine	multiple interactions	EXP		6480464	[Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of PPP2R1A protein	CTD	PMID:19464573
Ppp2r1a	Rat	actinomycin D	multiple interactions	ISO	RGD:1345219	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of PPP2R1A protein	CTD	PMID:38460933
Ppp2r1a	Rat	aflatoxin B1	increases methylation	ISO	RGD:1345219	6480464	Aflatoxin B1 results in increased methylation of PPP2R1A gene; Aflatoxin B1 results in increased methylation more ...	CTD	PMID:28458013\|PMID:30157460
Ppp2r1a	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PPP2R1A mRNA	CTD	PMID:16483693
Ppp2r1a	Rat	arsane	affects expression	ISO	RGD:1345219	6480464	Arsenic affects the expression of PPP2R1A mRNA	CTD	PMID:18414638
Ppp2r1a	Rat	arsane	multiple interactions	ISO	RGD:1345219	6480464	[arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PPP2R1A more ...	CTD	PMID:35809665
Ppp2r1a	Rat	arsenic atom	affects expression	ISO	RGD:1345219	6480464	Arsenic affects the expression of PPP2R1A mRNA	CTD	PMID:18414638
Ppp2r1a	Rat	arsenic atom	multiple interactions	ISO	RGD:1345219	6480464	[arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PPP2R1A more ...	CTD	PMID:35809665
Ppp2r1a	Rat	arsenic trichloride	multiple interactions	ISO	RGD:1345219	6480464	[arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PPP2R1A more ...	CTD	PMID:35809665
Ppp2r1a	Rat	atrazine	increases expression	ISO	RGD:1345219	6480464	Atrazine results in increased expression of PPP2R1A mRNA	CTD	PMID:22378314
Ppp2r1a	Rat	benzene	increases expression	EXP		6480464	Benzene results in increased expression of PPP2R1A mRNA	CTD	PMID:15878777
Ppp2r1a	Rat	benzene	multiple interactions	ISO	RGD:1550262	6480464	PPP2R1A protein affects the reaction [Benzene results in increased expression of and results in decreased more ...	CTD	PMID:30567741
Ppp2r1a	Rat	benzene	affects response to substance	ISO	RGD:1550262	6480464	PPP2R1A protein affects the susceptibility to Benzene	CTD	PMID:30567741
Ppp2r1a	Rat	bexarotene	increases expression	EXP		6480464	bexarotene results in increased expression of PPP2R1A mRNA	CTD	PMID:16648578
Ppp2r1a	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1550262	6480464	Diethylhexyl Phthalate results in increased expression of PPP2R1A mRNA	CTD	PMID:33754040
Ppp2r1a	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of PPP2R1A mRNA	CTD	PMID:25181051
Ppp2r1a	Rat	bisphenol A	decreases expression	ISO	RGD:1345219	6480464	bisphenol A results in decreased expression of PPP2R1A protein	CTD	PMID:34186270
Ppp2r1a	Rat	bisphenol AF	increases expression	ISO	RGD:1345219	6480464	bisphenol AF results in increased expression of PPP2R1A protein	CTD	PMID:34186270
Ppp2r1a	Rat	Bisphenol B	increases expression	ISO	RGD:1345219	6480464	bisphenol B results in increased expression of PPP2R1A protein	CTD	PMID:34186270
Ppp2r1a	Rat	bisphenol F	increases expression	ISO	RGD:1345219	6480464	bisphenol F results in increased expression of PPP2R1A protein	CTD	PMID:34186270
Ppp2r1a	Rat	butan-1-ol	multiple interactions	ISO	RGD:1345219	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Ppp2r1a	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of PPP2R1A mRNA	CTD	PMID:19167457
Ppp2r1a	Rat	cadmium atom	multiple interactions	ISO	RGD:1345219	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Ppp2r1a	Rat	cadmium dichloride	decreases response to substance	ISO	RGD:1345219	6480464	PPP2R1A protein results in decreased susceptibility to Cadmium Chloride	CTD	PMID:24962574
Ppp2r1a	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1345219	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Ppp2r1a	Rat	cadmium dichloride	affects response to substance	ISO	RGD:1550262	6480464	PPP2R1A protein affects the susceptibility to Cadmium Chloride	CTD	PMID:35183672
Ppp2r1a	Rat	cadmium dichloride	decreases expression	ISO	RGD:1550262	6480464	Cadmium Chloride results in decreased expression of PPP2R1A protein	CTD	PMID:35183672
Ppp2r1a	Rat	camptothecin	decreases response to substance	ISO	RGD:1345219	6480464	PPP2R1A mRNA results in decreased susceptibility to Camptothecin	CTD	PMID:25269479
Ppp2r1a	Rat	camptothecin	affects localization	ISO	RGD:1345219	6480464	Camptothecin affects the localization of PPP2R1A protein	CTD	PMID:25772433
Ppp2r1a	Rat	carbon nanotube	increases expression	ISO	RGD:1550262	6480464	Nanotubes, Carbon analog results in increased expression of PPP2R1A mRNA	CTD	PMID:25554681
Ppp2r1a	Rat	chlorogenic acid	multiple interactions	ISO	RGD:1345219	6480464	[Chlorogenic Acid co-treated with Acetaminophen] results in decreased expression of PPP2R1A protein	CTD	PMID:29136249
Ppp2r1a	Rat	chlorpyrifos	increases expression	ISO	RGD:1550262	6480464	Chlorpyrifos results in increased expression of PPP2R1A mRNA	CTD	PMID:37019170
Ppp2r1a	Rat	clobetasol	increases expression	ISO	RGD:1550262	6480464	Clobetasol results in increased expression of PPP2R1A mRNA	CTD	PMID:27462272
Ppp2r1a	Rat	clozapine	increases expression	EXP		6480464	Clozapine results in increased expression of PPP2R1A mRNA	CTD	PMID:15860345
Ppp2r1a	Rat	cobalt dichloride	decreases expression	ISO	RGD:1345219	6480464	cobaltous chloride results in decreased expression of PPP2R1A mRNA	CTD	PMID:19376846
Ppp2r1a	Rat	copper atom	multiple interactions	ISO	RGD:1345219	6480464	[Chelating Agents binds to Copper] which results in decreased expression of PPP2R1A mRNA	CTD	PMID:30911355
Ppp2r1a	Rat	copper(0)	multiple interactions	ISO	RGD:1345219	6480464	[Chelating Agents binds to Copper] which results in decreased expression of PPP2R1A mRNA	CTD	PMID:30911355
Ppp2r1a	Rat	crocidolite asbestos	increases expression	ISO	RGD:1345219	6480464	Asbestos, Crocidolite results in increased expression of PPP2R1A mRNA	CTD	PMID:29523930
Ppp2r1a	Rat	CU-O LINKAGE	increases expression	ISO	RGD:1345219	6480464	cupric oxide results in increased expression of PPP2R1A protein	CTD	PMID:25470785
Ppp2r1a	Rat	decabromodiphenyl ether	decreases expression	ISO	RGD:1345219	6480464	decabromobiphenyl ether results in decreased expression of PPP2R1A protein	CTD	PMID:31675489
Ppp2r1a	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1345219	6480464	di-n-butylphosphoric acid affects the expression of PPP2R1A mRNA	CTD	PMID:37042841
Ppp2r1a	Rat	doxorubicin	increases expression	ISO	RGD:1345219	6480464	Doxorubicin results in increased expression of PPP2R1A mRNA	CTD	PMID:29803840
Ppp2r1a	Rat	elemental selenium	multiple interactions	ISO	RGD:1345219	6480464	[Selenium co-treated with Vitamin E] results in increased expression of PPP2R1A mRNA	CTD	PMID:19244175
Ppp2r1a	Rat	elemental selenium	increases expression	ISO	RGD:1345219	6480464	Selenium results in increased expression of PPP2R1A mRNA	CTD	PMID:19244175
Ppp2r1a	Rat	enzyme inhibitor	multiple interactions	ISO	RGD:1345219	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Ppp2r1a	Rat	epoxiconazole	decreases expression	ISO	RGD:1550262	6480464	epoxiconazole results in decreased expression of PPP2R1A mRNA	CTD	PMID:35436446
Ppp2r1a	Rat	ethanol	affects splicing	ISO	RGD:1550262	6480464	Ethanol affects the splicing of PPP2R1A mRNA	CTD	PMID:30319688
Ppp2r1a	Rat	fenpyroximate	decreases expression	ISO	RGD:1345219	6480464	fenpyroximate results in decreased expression of PPP2R1A mRNA	CTD	PMID:33512557
Ppp2r1a	Rat	fenthion	increases expression	ISO	RGD:1550262	6480464	Fenthion results in increased expression of PPP2R1A mRNA	CTD	PMID:34813904
Ppp2r1a	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of PPP2R1A mRNA	CTD	PMID:24136188
Ppp2r1a	Rat	folic acid	multiple interactions	ISO	RGD:1550262	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PPP2R1A mRNA]	CTD	PMID:22206623
Ppp2r1a	Rat	formaldehyde	increases expression	ISO	RGD:1345219	6480464	Formaldehyde results in increased expression of PPP2R1A mRNA	CTD	PMID:18045764
Ppp2r1a	Rat	FR900359	increases phosphorylation	ISO	RGD:1345219	6480464	FR900359 results in increased phosphorylation of PPP2R1A protein	CTD	PMID:37730182
Ppp2r1a	Rat	furfural	multiple interactions	ISO	RGD:1345219	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Ppp2r1a	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PPP2R1A mRNA	CTD	PMID:22061828\|PMID:33387578
Ppp2r1a	Rat	glyphosate	decreases expression	ISO	RGD:1345219	6480464	Glyphosate results in decreased expression of PPP2R1A mRNA	CTD	PMID:31295307
Ppp2r1a	Rat	gold atom	decreases expression	ISO	RGD:1550262	6480464	Gold analog results in decreased expression of PPP2R1A protein	CTD	PMID:24780912
Ppp2r1a	Rat	gold(0)	decreases expression	ISO	RGD:1550262	6480464	Gold analog results in decreased expression of PPP2R1A protein	CTD	PMID:24780912
Ppp2r1a	Rat	haloperidol	increases expression	EXP		6480464	Haloperidol results in increased expression of PPP2R1A mRNA	CTD	PMID:15860345
Ppp2r1a	Rat	hypochlorous acid	decreases expression	ISO	RGD:1550262	6480464	Hypochlorous Acid results in decreased expression of PPP2R1A mRNA	CTD	PMID:19376150
Ppp2r1a	Rat	ivermectin	decreases expression	ISO	RGD:1345219	6480464	Ivermectin results in decreased expression of PPP2R1A protein	CTD	PMID:32959892
Ppp2r1a	Rat	lead(0)	decreases expression	ISO	RGD:1345219	6480464	Lead results in decreased expression of PPP2R1A mRNA	CTD	PMID:19921347
Ppp2r1a	Rat	lovastatin	increases expression	ISO	RGD:1550262	6480464	Lovastatin results in increased expression of PPP2R1A mRNA	CTD	PMID:20493250
Ppp2r1a	Rat	methidathion	increases expression	ISO	RGD:1550262	6480464	methidathion results in increased expression of PPP2R1A mRNA	CTD	PMID:34813904
Ppp2r1a	Rat	miconazole	increases expression	ISO	RGD:1550262	6480464	Miconazole results in increased expression of PPP2R1A mRNA	CTD	PMID:27462272
Ppp2r1a	Rat	microcystin RR	increases expression	ISO	RGD:1345219	6480464	microcystin RR results in increased expression of PPP2R1A protein	CTD	PMID:19111056
Ppp2r1a	Rat	microcystin-LR	increases expression	EXP		6480464	cyanoginosin LR results in increased expression of PPP2R1A protein	CTD	PMID:22000993
Ppp2r1a	Rat	microcystin-LR	decreases expression	ISO	RGD:1345219	6480464	cyanoginosin LR results in decreased expression of PPP2R1A protein	CTD	PMID:27393157
Ppp2r1a	Rat	microcystin-LR	multiple interactions	ISO	RGD:1345219	6480464	cyanoginosin LR inhibits the reaction [PPP2CA protein binds to PPP2R1A protein]; cyanoginosin LR inhibits the more ...	CTD	PMID:27393157\|PMID:29984889
Ppp2r1a	Rat	microcystin-LR	increases expression	ISO	RGD:1345219	6480464	cyanoginosin LR results in increased expression of PPP2R1A protein	CTD	PMID:18214937
Ppp2r1a	Rat	N-Vinyl-2-pyrrolidone	multiple interactions	EXP		6480464	[N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of PPP2R1A mRNA	CTD	PMID:22037397
Ppp2r1a	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of PPP2R1A mRNA	CTD	PMID:24136188
Ppp2r1a	Rat	nickel sulfate	increases expression	ISO	RGD:1345219	6480464	nickel sulfate results in increased expression of PPP2R1A mRNA	CTD	PMID:18651567
Ppp2r1a	Rat	niclosamide	increases expression	ISO	RGD:1345219	6480464	Niclosamide results in increased expression of PPP2R1A mRNA	CTD	PMID:22576131
Ppp2r1a	Rat	nitrates	multiple interactions	ISO	RGD:1550262	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PPP2R1A more ...	CTD	PMID:35964746
Ppp2r1a	Rat	Nutlin-3	multiple interactions	ISO	RGD:1345219	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of PPP2R1A protein	CTD	PMID:38460933
Ppp2r1a	Rat	okadaic acid	increases expression	ISO	RGD:1345219	6480464	Okadaic Acid results in increased expression of PPP2R1A protein	CTD	PMID:18937299
Ppp2r1a	Rat	paracetamol	affects expression	ISO	RGD:1550262	6480464	Acetaminophen affects the expression of PPP2R1A mRNA	CTD	PMID:17562736
Ppp2r1a	Rat	paracetamol	multiple interactions	ISO	RGD:1345219	6480464	[Chlorogenic Acid co-treated with Acetaminophen] results in decreased expression of PPP2R1A protein	CTD	PMID:29136249
Ppp2r1a	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1550262	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPP2R1A mRNA	CTD	PMID:36331819
Ppp2r1a	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of PPP2R1A mRNA	CTD	PMID:22037397
Ppp2r1a	Rat	pyrazinecarboxamide	increases expression	EXP		6480464	Pyrazinamide results in increased expression of PPP2R1A mRNA	CTD	PMID:22431067
Ppp2r1a	Rat	selenium atom	multiple interactions	ISO	RGD:1345219	6480464	[Selenium co-treated with Vitamin E] results in increased expression of PPP2R1A mRNA	CTD	PMID:19244175
Ppp2r1a	Rat	selenium atom	increases expression	ISO	RGD:1345219	6480464	Selenium results in increased expression of PPP2R1A mRNA	CTD	PMID:19244175
Ppp2r1a	Rat	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of PPP2R1A protein	CTD	PMID:29459688
Ppp2r1a	Rat	sodium arsenite	increases expression	ISO	RGD:1345219	6480464	sodium arsenite results in increased expression of PPP2R1A mRNA	CTD	PMID:34032870
Ppp2r1a	Rat	sodium arsenite	multiple interactions	ISO	RGD:1345219	6480464	PPP2R1A protein affects the reaction [sodium arsenite results in decreased phosphorylation of TFE3 protein]	CTD	PMID:29945972
Ppp2r1a	Rat	sodium chloride	multiple interactions	ISO	RGD:1345219	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Ppp2r1a	Rat	sulindac sulfide	decreases expression	ISO	RGD:1345219	6480464	sulindac sulfide results in decreased expression of PPP2R1A mRNA	CTD	PMID:12734198
Ppp2r1a	Rat	sunitinib	decreases expression	ISO	RGD:1345219	6480464	Sunitinib results in decreased expression of PPP2R1A mRNA	CTD	PMID:31533062
Ppp2r1a	Rat	thapsigargin	decreases expression	ISO	RGD:1345219	6480464	Thapsigargin results in decreased expression of PPP2R1A mRNA	CTD	PMID:22378314
Ppp2r1a	Rat	titanium dioxide	decreases methylation	ISO	RGD:1550262	6480464	titanium dioxide results in decreased methylation of PPP2R1A promoter	CTD	PMID:35295148
Ppp2r1a	Rat	titanium dioxide	affects methylation	ISO	RGD:1550262	6480464	titanium dioxide affects the methylation of PPP2R1A gene	CTD	PMID:35295148
Ppp2r1a	Rat	tunicamycin	decreases expression	ISO	RGD:1345219	6480464	Tunicamycin results in decreased expression of PPP2R1A mRNA	CTD	PMID:22378314
Ppp2r1a	Rat	valproic acid	decreases expression	ISO	RGD:1345219	6480464	Valproic Acid results in decreased expression of PPP2R1A mRNA	CTD	PMID:29154799
Ppp2r1a	Rat	valproic acid	decreases methylation	ISO	RGD:1345219	6480464	Valproic Acid results in decreased methylation of PPP2R1A gene	CTD	PMID:29154799
Ppp2r1a	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of PPP2R1A mRNA	CTD	PMID:19015723
Ppp2r1a	Rat	vitamin E	multiple interactions	ISO	RGD:1345219	6480464	[Selenium co-treated with Vitamin E] results in increased expression of PPP2R1A mRNA	CTD	PMID:19244175
Ppp2r1a	Rat	vitamin E	increases expression	ISO	RGD:1345219	6480464	Vitamin E results in increased expression of PPP2R1A mRNA	CTD	PMID:19244175
Ppp2r1a	Rat	warfarin	increases expression	ISO	RGD:1550262	6480464	Warfarin results in increased expression of PPP2R1A mRNA	CTD	PMID:20493250
Ppp2r1a	Rat	WIN 55212-2	decreases expression	ISO	RGD:1550262	6480464	(3R)-((2,3-dihydro-5-methyl-3-((4-morpholinyl)methyl)pyrrolo-(1,2,3-de)-1,4-benzoxazin-6-yl)(1-naphthalenyl))methanone results in decreased expression of PPP2R1A mRNA	CTD	PMID:12237329
Ppp2r1a	Rat	zinc atom	increases expression	EXP		6480464	Zinc deficiency results in increased expression of PPP2R1A mRNA; Zinc deficiency results in increased expression more ...	CTD	PMID:19111725
Ppp2r1a	Rat	zinc sulfate	decreases response to substance	ISO	RGD:1345219	6480464	PPP2R1A protein results in decreased susceptibility to Zinc Sulfate	CTD	PMID:24962574
Ppp2r1a	Rat	zinc(0)	increases expression	EXP		6480464	Zinc deficiency results in increased expression of PPP2R1A mRNA; Zinc deficiency results in increased expression more ...	CTD	PMID:19111725

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	chromosome segregation	involved_in	ISO	RGD:1345219	1624291	PMID:16580887	RGD	PMID:16580887
Ppp2r1a	Rat	female meiotic nuclear division	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	MGI:5287252 PMID:24899574	RGD	PMID:24899574
Ppp2r1a	Rat	meiotic sister chromatid cohesion, centromeric	involved_in	IBA	MGI:1926334\|PANTHER:PTN000068664\|PomBase:SPAP8A3.09c	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	meiotic sister chromatid cohesion, centromeric	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	MGI:5287252 PMID:24899574	RGD	PMID:24899574
Ppp2r1a	Rat	meiotic spindle elongation	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	MGI:5287252 PMID:24899574	RGD	PMID:24899574
Ppp2r1a	Rat	mitotic sister chromatid separation	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	MGI:5287252 PMID:24899574	RGD	PMID:24899574
Ppp2r1a	Rat	negative regulation of hippo signaling	involved_in	ISO	RGD:1345219	1624291	PMID:33633399	RGD	PMID:33633399
Ppp2r1a	Rat	negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	ISO	RGD:1550262	1624291	PMID:26974206	RGD	PMID:26974206
Ppp2r1a	Rat	peptidyl-serine dephosphorylation	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	PMID:12944463	RGD	PMID:12944463
Ppp2r1a	Rat	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	PMID:12944463	RGD	PMID:12944463
Ppp2r1a	Rat	regulation of meiotic cell cycle process involved in oocyte maturation	acts_upstream_of_or_within	ISO	RGD:1550262	1624291	MGI:5287252 PMID:24899574	RGD	PMID:24899574
Ppp2r1a	Rat	RNA polymerase II transcription initiation surveillance	involved_in	ISO	RGD:1345219	1624291	PMID:33243860, PMID:34004147, PMID:38570683	RGD	PMID:33243860\|PMID:34004147\|PMID:38570683
Ppp2r1a	Rat	spindle assembly	involved_in	IBA	FB:FBgn0260439\|PANTHER:PTN000068664	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	T cell homeostasis	involved_in	ISO	RGD:1550262	1624291	PMID:26974206	RGD	PMID:26974206

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	chromatin	is_active_in	ISO	RGD:1345219	1624291	PMID:33243860, PMID:34004147	RGD	PMID:33243860\|PMID:34004147
Ppp2r1a	Rat	chromosome, centromeric region	located_in	ISO	RGD:1345219	1624291	PMID:16580887	RGD	PMID:16580887
Ppp2r1a	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0260439\|MGI:1926334\|PANTHER:PTN000068596\|PomBase:SPAP8A3.09c\|SGD:S000000014\|UniProtKB:Q32PI5\|WB:WBGene00003901\|WB:WBGene00008878\|dictyBase:DDB_G0283601	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	cytosol	located_in	ISO	RGD:1550262	1624291	PMID:12885400	RGD	PMID:12885400
Ppp2r1a	Rat	cytosol	is_active_in	IBA	FB:FBgn0260439\|MGI:1926334\|PANTHER:PTN000068663	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	FAR/SIN/STRIPAK complex	part_of	ISO	RGD:1345219	1624291	PMID:18782753, PMID:33633399	RGD	PMID:18782753\|PMID:33633399
Ppp2r1a	Rat	glutamatergic synapse	is_active_in	ISO	RGD:1550262	1624291	PMID:24413018	RGD	PMID:24413018
Ppp2r1a	Rat	INTAC complex	part_of	ISO	RGD:1345219	1624291	PMID:33243860, PMID:34004147, PMID:34762484, PMID:36869814, PMID:38570683	RGD	PMID:33243860\|PMID:34004147\|PMID:34762484\|PMID:36869814\|PMID:38570683
Ppp2r1a	Rat	lateral plasma membrane	located_in	ISO	RGD:1345219	1624291	PMID:15525651	RGD	PMID:15525651
Ppp2r1a	Rat	neuron projection	located_in	ISO	RGD:1345219	1624291	PMID:15525651	RGD	PMID:15525651
Ppp2r1a	Rat	neuronal cell body	located_in	ISO	RGD:1345219	1624291	PMID:15525651	RGD	PMID:15525651
Ppp2r1a	Rat	nucleus	located_in	ISO	RGD:1345219	1624291	PMID:30611118	RGD	PMID:30611118
Ppp2r1a	Rat	nucleus	is_active_in	ISO	RGD:1345219	1624291	PMID:33243860, PMID:34004147	RGD	PMID:33243860\|PMID:34004147
Ppp2r1a	Rat	nucleus	is_active_in	IBA	FB:FBgn0260439\|PANTHER:PTN000068663\|SGD:S000000014\|TAIR:locus:2031165\|TAIR:locus:2205354\|UniProtKB:P30153\|WB:WBGene00003901	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	protein phosphatase type 2A complex	part_of	ISO	RGD:1345219	1624291	PMID:17055435, PMID:17174897	RGD	PMID:17055435\|PMID:17174897
Ppp2r1a	Rat	protein phosphatase type 2A complex	part_of	ISO	RGD:1550262	1624291	PMID:16717086	RGD	PMID:16717086
Ppp2r1a	Rat	protein phosphatase type 2A complex	part_of	IBA	CGD:CAL0000188510\|MGI:1926334\|PANTHER:PTN000068663\|PomBase:SPAP8A3.09c\|SGD:S000000014\|UniProtKB:P30153\|WB:WBGene00003901\|dictyBase:DDB_G0283601	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	synapse	is_active_in	ISO	RGD:1550262	1624291	PMID:16452087, PMID:24413018	RGD	PMID:16452087\|PMID:24413018

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	protein antigen binding	enables	ISO	RGD:1345219	1624291	UniProtKB:P03077\|UniProtKB:P03081 PMID:9847399	RGD	PMID:9847399
Ppp2r1a	Rat	protein binding	enables	ISO	RGD:1345219	1624291	UniProtKB:O43597\|UniProtKB:O43815\|UniProtKB:O43815-2\|UniProtKB:P03081\|UniProtKB:P03129\|UniProtKB:P04020\|UniProtKB:P04637\|UniProtKB:P30154\|UniProtKB:P31749\|UniProtKB:P51959\|UniProtKB:P53041\|UniProtKB:P53816\|UniProtKB:P60510\|UniProtKB:P63151\|UniProtKB:P67775\|UniProtKB:P67775-1\|UniProtKB:P68835\|UniProtKB:P97346\|UniProtKB:Q00005\|UniProtKB:Q03113\|UniProtKB:Q04206\|UniProtKB:Q06190\|UniProtKB:Q13033-2\|UniProtKB:Q13362\|UniProtKB:Q13362-1\|UniProtKB:Q13362-2\|UniProtKB:Q14155\|UniProtKB:Q14738\|UniProtKB:Q15172\|UniProtKB:Q15173\|UniProtKB:Q15257-2\|UniProtKB:Q16537\|UniProtKB:Q4G163\|UniProtKB:Q5FBB7\|UniProtKB:Q60996-3\|UniProtKB:Q8TCG1\|UniProtKB:Q91X84\|UniProtKB:Q96E09\|UniProtKB:Q96GD4\|UniProtKB:Q9C0C7\|UniProtKB:Q9NYA3\|UniProtKB:Q9Y2V2\|UniProtKB:Q9Y534\|UniProtKB:Q9Y5P8 PMID:11504734, PMID:11591705, PMID:15525651, PMID:15761952, PMID:16044149, PMID:16580887, PMID:16764867, PMID:17055435, PMID:17245430, PMID:17274953, PMID:17374643, PMID:17529992, PMID:17540176, more ...	RGD	PMID:11504734\|PMID:11591705\|PMID:15525651\|PMID:15761952\|PMID:16044149\|PMID:16580887\|PMID:16764867\|PMID:17055435\|PMID:17245430\|PMID:17274953\|PMID:17374643\|PMID:17529992\|PMID:17540176\|PMID:17632056\|PMID:17974561\|PMID:18394995\|PMID:18715871\|PMID:18782753\|PMID:19156129\|PMID:19293187\|PMID:19915589\|PMID:20711181\|PMID:21075311\|PMID:21460856\|PMID:22167190\|PMID:23555304\|PMID:25150978\|PMID:25241761\|PMID:25416956\|PMID:25438055\|PMID:26496610\|PMID:26829474\|PMID:27173435\|PMID:27588481\|PMID:27880917\|PMID:28174209\|PMID:28330616\|PMID:30611118\|PMID:31515488\|PMID:32296183\|PMID:32707033\|PMID:33633399\|PMID:33961781\|PMID:35271311\|PMID:37761890\|PMID:8617797\|PMID:9847399\|PMID:9857076
Ppp2r1a	Rat	protein binding	enables	ISO	RGD:1550262	1624291	PR:E9Q9D5\|PR:O35627\|PR:P06537\|PR:P10417\|PR:Q61337\|PR:Q9JK24\|PR:Q9Z176\|UniProtKB:O56327\|UniProtKB:P40146\|UniProtKB:P63330\|UniProtKB:Q06190 PMID:12885400, PMID:12944463, PMID:16258073, PMID:16717086, PMID:16857963, PMID:17608567, PMID:18715506, PMID:19818709, PMID:23055941	RGD	PMID:12885400\|PMID:12944463\|PMID:16258073\|PMID:16717086\|PMID:16857963\|PMID:17608567\|PMID:18715506\|PMID:19818709\|PMID:23055941
Ppp2r1a	Rat	protein heterodimerization activity	enables	ISO	RGD:1345219	1624291	UniProtKB:P67775 PMID:9847399	RGD	PMID:9847399
Ppp2r1a	Rat	protein phosphatase regulator activity	enables	IBA	PANTHER:PTN000068596\|TAIR:locus:2031165\|WB:WBGene00008878	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppp2r1a	Rat	protein phosphatase regulator activity	enables	ISO	RGD:1345219	1624291	PMID:33243860, PMID:34004147	RGD	PMID:33243860\|PMID:34004147
Ppp2r1a	Rat	protein serine/threonine phosphatase activity	enables	ISO	RGD:1550262	1624291	PMID:12944463	RGD	PMID:12944463

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	phosphatidylinositol 3-kinase-Akt signaling pathway		ISO	RGD:1345219	11535052		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	Chagas disease pathway		IEA		6907045		KEGG	rno:05142
Ppp2r1a	Rat	hepatitis C pathway		IEA		6907045		KEGG	rno:05160
Ppp2r1a	Rat	long term depression		IEA		6907045		KEGG	rno:04730
Ppp2r1a	Rat	mRNA decay pathway		IEA		6907045		KEGG	rno:03015
Ppp2r1a	Rat	transforming growth factor-beta superfamily mediated signaling pathway		IEA		6907045		KEGG	rno:04350
Ppp2r1a	Rat	Wnt signaling pathway		IEA		6907045		KEGG	rno:04310

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp2r1a	Rat	platelet-derived growth factor signaling pathway		ISO	RGD:1345219	6484113		PID	PID:200149

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autosomal dominant intellectual developmental disorder 36 (ISO)

Disease Progression (ISO)

gastric adenocarcinoma (ISO)

genetic disease (ISO)

head and neck squamous cell carcinoma (ISO)

intellectual disability (ISO)

Neurodevelopmental Disorders (ISO)

osteoarthritis (ISO)

osteogenesis imperfecta (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(R)-adrenaline (EXP)

(Z)-3-butylidenephthalide (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-bromohexadecanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-aza-2'-deoxycytidine (ISO)

7H-xanthine (EXP)

9H-xanthine (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

atrazine (ISO)

benzene (EXP,ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

carbon nanotube (ISO)

chlorogenic acid (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

clozapine (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

decabromodiphenyl ether (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenpyroximate (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

haloperidol (EXP)

hypochlorous acid (ISO)

ivermectin (ISO)

lead(0) (ISO)

lovastatin (ISO)

methidathion (ISO)

miconazole (ISO)

microcystin RR (ISO)

microcystin-LR (EXP,ISO)

N-Vinyl-2-pyrrolidone (EXP)

nefazodone (EXP)

nickel sulfate (ISO)

niclosamide (ISO)

nitrates (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

pyrazinecarboxamide (EXP)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

warfarin (ISO)

WIN 55212-2 (ISO)

zinc atom (EXP)

zinc sulfate (ISO)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromosome segregation (ISO)

female meiotic nuclear division (ISO)

meiotic sister chromatid cohesion, centromeric (IBA,ISO)

meiotic spindle elongation (ISO)

mitotic sister chromatid separation (ISO)

negative regulation of hippo signaling (ISO)

negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

peptidyl-serine dephosphorylation (ISO)

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand (ISO)

regulation of meiotic cell cycle process involved in oocyte maturation (ISO)

RNA polymerase II transcription initiation surveillance (ISO)

spindle assembly (IBA)

T cell homeostasis (ISO)

Cellular Component

chromatin (ISO)

chromosome, centromeric region (ISO)

cytoplasm (IBA)

cytosol (IBA,ISO)

FAR/SIN/STRIPAK complex (ISO)

glutamatergic synapse (ISO)

INTAC complex (ISO)

lateral plasma membrane (ISO)

neuron projection (ISO)

neuronal cell body (ISO)

nucleus (IBA,ISO)

protein phosphatase type 2A complex (IBA,ISO)

synapse (ISO)

Molecular Function

protein antigen binding (ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein phosphatase regulator activity (IBA,ISO)

protein serine/threonine phosphatase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

hepatitis C pathway (IEA)

long term depression (IEA)

mRNA decay pathway (IEA)

phosphatidylinositol 3-kinase-Akt signaling pathway (ISO)

platelet-derived growth factor signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of PP2A B regulatory subunit beta isotype in rat testis.	Hatano Y, etal., FEBS Lett 1993 Jun 7;324(1):71-5.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Phosphatase: PP2A structural importance, regulation and its aberrant expression in cancer.	Seshacharyulu P, etal., Cancer Lett. 2013 Jul 10;335(1):9-18. doi: 10.1016/j.canlet.2013.02.036. Epub 2013 Feb 20.

Additional References at PubMed

PMID:9847399	PMID:12477932	PMID:12885400	PMID:12944463	PMID:16452087	PMID:16580887	PMID:16717086	PMID:17055435	PMID:17174897	PMID:22871113	PMID:23533145	PMID:24413018
PMID:24465463	PMID:24899574	PMID:30611118

Genomics

Comparative Map Data

Ppp2r1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	69,213,198 - 69,232,441 (+)	NCBI		GRCr8
mRatBN7.2	1	60,540,223 - 60,559,467 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	60,540,194 - 60,560,129 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	65,329,720 - 65,348,961 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	74,024,287 - 74,043,556 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	67,239,755 - 67,258,997 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	60,717,386 - 60,736,629 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,717,386 - 60,736,609 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	61,883,998 - 61,903,241 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	58,442,220 - 58,461,462 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	58,458,861 - 58,463,770 (+)	NCBI
Celera	1	56,683,597 - 56,702,854 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

PPP2R1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	52,190,052 - 52,229,518 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	52,170,936 - 52,229,518 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	52,693,305 - 52,732,771 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	57,385,046 - 57,421,483 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	57,385,045 - 57,421,482	NCBI
Celera	19	49,742,609 - 49,779,232 (+)	NCBI		Celera
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	49,023,481 - 49,060,103 (+)	NCBI		HuRef
CHM1_1	19	52,694,941 - 52,731,564 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	55,277,246 - 55,316,713 (+)	NCBI		T2T-CHM13v2.0

Ppp2r1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	21,165,716 - 21,186,167 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	21,165,573 - 21,186,178 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	20,945,454 - 20,965,905 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	20,945,311 - 20,965,916 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	21,082,418 - 21,102,869 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	20,650,151 - 20,670,602 (+)	NCBI		MGSCv36	mm8
Celera	17	21,977,995 - 21,998,451 (+)	NCBI		Celera
Cytogenetic Map	17	A3.2	NCBI
cM Map	17	11.4	NCBI

Ppp2r1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955558	381,794 - 410,485 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955558	381,794 - 410,485 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP2R1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	58,232,259 - 58,268,655 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	60,156,718 - 60,193,105 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	49,133,295 - 49,169,447 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	58,011,383 - 58,047,577 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	58,011,383 - 58,047,577 (+)	Ensembl	panpan1.1		panPan2

PPP2R1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	104,974,059 - 105,013,745 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	104,974,072 - 105,013,663 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	104,546,959 - 104,586,647 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	105,482,896 - 105,522,584 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	105,481,754 - 105,522,572 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	105,155,353 - 105,195,079 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	104,809,802 - 104,849,707 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	105,597,164 - 105,636,892 (-)	NCBI		UU_Cfam_GSD_1.0

Ppp2r1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	3,866,510 - 3,896,513 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936901	622,888 - 653,044 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936901	622,893 - 653,044 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP2R1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	57,921,329 - 57,964,961 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	57,929,520 - 57,964,948 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	52,233,180 - 52,268,640 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP2R1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	44,990,402 - 45,026,210 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	44,990,367 - 45,026,227 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	25,047,701 - 25,083,506 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp2r1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	2,979,320 - 3,011,715 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	2,979,270 - 3,009,189 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppp2r1a
23 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	61
Interacting mature miRNAs:	66
Transcripts:	ENSRNOT00000015019
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

BF390652

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	69,221,741 - 69,222,599 (+)	Marker Load Pipeline
mRatBN7.2	1	60,548,767 - 60,549,625 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	60,725,930 - 60,726,787	NCBI	Rnor6.0
Rnor_5.0	1	61,892,542 - 61,893,399	UniSTS	Rnor5.0
RGSC_v3.4	1	58,450,763 - 58,451,620	UniSTS	RGSC3.4
Celera	1	56,692,156 - 56,693,013	UniSTS
RH 3.4 Map	15	328.88	UniSTS
Cytogenetic Map	1	q12	UniSTS

Ppp2r1b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	84,259,139 - 84,259,515 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	92,488,389 - 92,488,764	NCBI	Rnor6.0
Rnor_5.0	7	93,130,340 - 93,130,715	UniSTS	Rnor5.0
RGSC_v3.4	7	89,259,069 - 89,259,444	UniSTS	RGSC3.4
Celera	7	81,099,995 - 81,100,370	UniSTS
Cytogenetic Map	7	q31	UniSTS
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015019 ⟹ ENSRNOP00000015019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	60,540,194 - 60,560,129 (+)	Ensembl
Rnor_6.0 Ensembl	1	60,717,386 - 60,736,609 (+)	Ensembl

RefSeq Acc Id:

NM_057140 ⟹ NP_476481

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	69,213,198 - 69,232,441 (+)	NCBI
mRatBN7.2	1	60,540,223 - 60,559,467 (+)	NCBI
Rnor_6.0	1	60,717,386 - 60,736,629 (+)	NCBI
Rnor_5.0	1	61,883,998 - 61,903,241 (+)	NCBI
RGSC_v3.4	1	58,442,220 - 58,461,462 (+)	RGD
Celera	1	56,683,597 - 56,702,854 (+)	RGD

Sequence:

show sequence

GATGGCAGCTGCCGACGGCGACGATTCGCTCTACCCCATTGCGGTGCTCATAGATGAACTGCGC
AATGAGGACGTTCAGCTTCGTCTCAATAGTATCAAGAAGCTCTCCACCATTGCCTTGGCCCTTG
GGGTTGAACGGACCAGAAGTGAGCTCCTGCCCTTTCTTACAGATACCATCTATGATGAAGATGA
GGTCCTCTTGGCTTTGGCTGAACAGCTGGGAACCTTCACCACTTTGGTGGGAGGACCCGAGTAT
GTGCACTGTCTGCTGCCACCTCTTGAGTCACTGGCCACAGTGGAAGAGACAGTAGTGCGAGACA
AGGCGGTAGAATCCTTGCGGGCCATCTCTCATGAGCACTCACCTTCCGATCTAGAGGCTCACTT
TGTGCCTCTGGTGAAGCGGCTGGCGGGTGGAGACTGGTTCACCTCCCGTACCTCAGCCTGTGGT
CTCTTCTCAGTTTGCTACCCCCGAGTATCCAGTGCCGTGAAGGCAGAACTTCGACAGTACTTCC
GGAACCTGTGCTCAGATGATACCCCCATGGTGCGGCGGGCCGCTGCCTCCAAGCTGGGGGAGTT
TGCCAAGGTACTGGAGCTGGACAATGTCAAGAGTGAGATCATTCCCATGTTCTCTAACCTGGCC
TCTGACGAGCAGGACTCGGTGCGGCTGCTGGCAGTAGAGGCATGCGTGAATATCGCCCAGCTTC
TGCCCCAGGAGGACCTGGAGGCCTTAGTGATGCCCACCTTGCGACAGGCTGCTGAGGACAAGTC
TTGGCGTGTCCGCTACATGGTGGCAGACAAATTCACAGAGCTCCAGAAAGCAGTTGGGCCTGAG
ATCACTAAGACAGATCTGGTGCCTGCCTTCCAGAACCTGATGAAAGACTGTGAGGCCGAGGTGA
GGGCCGCAGCCTCCCACAAGGTCAAAGAGTTCTGTGAAAATCTCTCAGCTGACTGCCGGGAGAA
TGTGATCATGACCCAGATCTTGCCCTGCATCAAGGAACTCGTGTCCGATGCCAACCAACATGTC
AAGTCAGCACTGGCTTCAGTCATCATGGGCCTCTCTCCCATTCTGGGCAAAGACAATACCATCG
AACACCTCTTGCCCCTGTTCTTGGCTCAGCTGAAGGATGAGTGTCCTGAGGTGCGGCTGAACAT
CATTTCCAACCTGGATTGTGTGAATGAAGTGATTGGCATCCGGCAGCTCTCGCAGTCCTTGCTT
CCTGCCATCGTGGAACTCGCTGAAGATGCCAAGTGGCGAGTGCGGCTGGCCATCATTGAATACA
TGCCTCTGCTGGCTGGACAGCTCGGTGTGGAATTTTTTGATGAGAAACTTAACTCTTTGTGTAT
GGCCTGGCTAGTGGATCATGTCTATGCTATCCGTGAGGCTGCCACCAGCAACCTTAAGAAGCTA
GTGGAGAAGTTCGGGAAGGAGTGGGCCCATGCCACTATCATCCCCAAGGTCTTAGCCATGTCTG
GAGACCCTAACTACCTGCACCGAATGACTACACTCTTCTGCATCAATGTGTTGTCTGAGGTCTG
TGGGCAGGATATTACCACGAAGCACATGCTGCCCACAGTTCTTCGTATGGCTGGGGACCCAGTC
GCCAATGTCCGCTTCAATGTGGCCAAGTCACTACAGAAGATAGGACCCATTCTTGATAACAGCA
CCCTGCAAAGTGAAGTCAAGCCTATCCTAGAGAAGCTGACCCAGGACCAGGATGTGGATGTCAA
GTACTTTGCCCAGGAGGCTCTGACTGTTCTCTCTCTTGCCTGATGCTGGAAGAAGAAGCATTGC
CGGCCTCTGGTGTCCACCCTCCAACCCCCACAGTTACCTCCCTTAGGGAGGTGGTGGGAGCAAA
TGACTGTCGCTCCCGTGCATGGTCTGACCCCAGGCCCCTCCCTCAGCACGGTTTGGTTTCTCCT
CTCTGTAGCCTGGGAAGACTTCTCTGTCCACCTCCTGCGGGGCTGGGGCAGTACAAGTTGGGGC
AGGACAGCAGCCTGAAAAGAAGGTCTGGTTGTTCCTGCCCATATTGGGAGAGATGGGAGCATCC
TAGGTCACTGGCTTTTGCTGCTGTAATGGGGACCCCCCTCCCCCATCTACTTACAAGCACCCTT
TCCTAACCCCAACCATGTTTTTTTGTGTGTGTCAATTGTGCCATTTTTATTTTATTCCTTTCCC
TACTCTTTACACAGAATAAAAATGTAGAAATAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_476481	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83859	(Get FASTA)	NCBI Sequence Viewer
	BAA21903	(Get FASTA)	NCBI Sequence Viewer
	EDL99781	(Get FASTA)	NCBI Sequence Viewer
	EDL99782	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015019
	ENSRNOP00000015019.4

RefSeq Acc Id:

NP_476481 ⟸ NM_057140

- UniProtKB:

Q5XI34 (UniProtKB/TrEMBL), F7EWM3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDE
VLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHF
VPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEF
AKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKS
WRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCREN
VIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNI
ISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCM
AWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVC
GQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVK
YFAQEALTVLSLA

hide sequence

Ensembl Acc Id:

ENSRNOP00000015019 ⟸ ENSRNOT00000015019

Protein Domains

Phosphatase PP2A regulatory subunit A/Splicing

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI34-F1-model_v2	AlphaFold	Q5XI34	1-589	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689651

Promoter ID:

EPDNEW_R176

Type:

initiation region

Name:

Ppp2r1a_1

Description:

protein phosphatase 2 scaffold subunit A alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	60,717,308 - 60,717,368	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620907	AgrOrtholog
BioCyc Gene	G2FUF-61200	BioCyc
Ensembl Genes	ENSRNOG00000011282	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015019	ENTREZGENE
	ENSRNOT00000015019.7	UniProtKB/TrEMBL
Gene3D-CATH	1.25.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7126254	IMAGE-MGC_LOAD
InterPro	ARM-like	UniProtKB/TrEMBL
	ARM-type_fold	UniProtKB/TrEMBL
	HEAT	UniProtKB/TrEMBL
	HEAT_type_2	UniProtKB/TrEMBL
	PP2A/SF3B1-like_HEAT	UniProtKB/TrEMBL
	PP2A_Regulatory_Subunit_A	UniProtKB/TrEMBL
KEGG Report	rno:117281	UniProtKB/TrEMBL
MGC_CLONE	MGC:95083	IMAGE-MGC_LOAD
NCBI Gene	117281	ENTREZGENE
PANTHER	PTHR10648:SF2	UniProtKB/TrEMBL
	SERINE/THREONINE-PROTEIN PHOSPHATASE PP2A 65 KDA REGULATORY SUBUNIT	UniProtKB/TrEMBL
Pfam	HEAT	UniProtKB/TrEMBL
	HEAT_2	UniProtKB/TrEMBL
	PPP2R1A-like_HEAT	UniProtKB/TrEMBL
PhenoGen	Ppp2r1a	PhenoGen
PROSITE	HEAT_REPEAT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011282	RatGTEx
Superfamily-SCOP	ARM-type_fold	UniProtKB/TrEMBL
UniProt	A6KB84_RAT	UniProtKB/TrEMBL
	F7EWM3	ENTREZGENE, UniProtKB/TrEMBL
	Q5XI34	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-18	Ppp2r1a	protein phosphatase 2 scaffold subunit A alpha	Ppp2r1a	protein phosphatase 2, regulatory subunit A, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Ppp2r1a	protein phosphatase 2, regulatory subunit A, alpha	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)