F2rl2 (coagulation factor II (thrombin) receptor-like 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: F2rl2 (coagulation factor II (thrombin) receptor-like 2) Rattus norvegicus

Analyze

Symbol:

F2rl2

Name:

coagulation factor II (thrombin) receptor-like 2

RGD ID:

620871

Description:

Predicted to enable several functions, including enzyme activator activity; ion channel regulator activity; and proteinase-activated receptor activity. Involved in response to wounding. Predicted to be located in apical plasma membrane. Predicted to be part of protein-containing complex. Predicted to be active in plasma membrane. Orthologous to human F2RL2 (coagulation factor II thrombin receptor like 2); PARTICIPATES IN insulin signaling pathway; protease mediated signaling via protease-activated receptor 3; INTERACTS WITH (S)-nicotine; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

coagulation factor II receptor-like 2; PAR-3; PAR3; protease-activated receptor 3; proteinase-activated receptor 3; thrombin receptor-like 2

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	26,972,054 - 26,977,098 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	26,972,054 - 26,977,098 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	34,011,700 - 34,016,699 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	32,111,806 - 32,116,807 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	26,928,439 - 26,933,433 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	26,240,385 - 26,245,533 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	26,240,385 - 26,245,533 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	45,371,780 - 45,376,928 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	26,073,852 - 26,078,618 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	25,994,220 - 25,998,987 (+)	NCBI
Celera	2	23,033,959 - 23,038,978 (+)	NCBI		Celera
Cytogenetic Map	2	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

acetamiprid (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

dioxygen (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

flavonoids (EXP)

imidacloprid (EXP)

lead diacetate (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

nickel sulfate (ISO)

nicotine (EXP)

O-methyleugenol (ISO)

oxaliplatin (EXP)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

phenethyl isothiocyanate (ISO)

phenformin (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

progesterone (ISO)

quercitrin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vorinostat (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood coagulation (IEA)

ion channel modulating, G protein-coupled receptor signaling pathway (IEA,ISO)

ligand-gated ion channel signaling pathway (IEA,ISO)

positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway (IBA)

positive regulation of insulin secretion (IEA,ISO)

positive regulation of Rho protein signal transduction (IBA)

response to wounding (IEP)

thrombin-activated receptor signaling pathway (IEA)

Cellular Component

apical plasma membrane (IEA,ISO)

plasma membrane (IBA)

protein-containing complex (IEA,ISO)

Molecular Function

calcium channel regulator activity (IEA,ISO)

channel activator activity (IEA,ISO)

enzyme regulator activity (ISO)

G protein-coupled receptor activity (IBA,TAS)

GTPase activator activity (IEA,ISO)

ion channel regulator activity involved in G protein-coupled receptor signaling pathway (IEA,ISO)

phospholipase activator activity (IEA,ISO)

protein binding (ISO)

protein serine/threonine kinase activator activity (IEA,ISO)

proteinase-activated receptor activity (ISO)

receptor ligand activity (IEA,ISO)

thrombin-activated receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin signaling pathway (ISO)

protease mediated signaling via protease-activated receptor 3 (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cross Talk Pathways Between Coagulation and Inflammation.	Foley JH and Conway EM, Circ Res. 2016 Apr 29;118(9):1392-408. doi: 10.1161/CIRCRESAHA.116.306853.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Increase of prothrombin-mRNA after global cerebral ischemia in rats, with constant expression of protease nexin-1 and protease-activated receptors.	Riek-Burchardt M, etal., Neurosci Lett 2002 Aug 30;329(2):181-4.
11.	Protease-activated receptor subtype expression in developing eye and adult retina of the rat after optic nerve crush.	Rohatgi T, etal., J Neurosci Res 2003 Jul 15;73(2):246-54.
12.	Transient focal ischemia in rat brain differentially regulates mRNA expression of protease-activated receptors 1 to 4.	Rohatgi T, etal., J Neurosci Res 2004 Jan 15;75(2):273-9.

Additional References at PubMed

PMID:1299297	PMID:16403464	PMID:16458856	PMID:16892058	PMID:17136598

Genomics

Comparative Map Data

F2rl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	26,972,054 - 26,977,098 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	26,972,054 - 26,977,098 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	34,011,700 - 34,016,699 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	32,111,806 - 32,116,807 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	26,928,439 - 26,933,433 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	26,240,385 - 26,245,533 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	26,240,385 - 26,245,533 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	45,371,780 - 45,376,928 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	26,073,852 - 26,078,618 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	25,994,220 - 25,998,987 (+)	NCBI
Celera	2	23,033,959 - 23,038,978 (+)	NCBI		Celera
Cytogenetic Map	2	q12	NCBI

F2RL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	76,615,482 - 76,623,403 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	76,615,482 - 76,623,413 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	75,911,307 - 75,919,228 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	75,947,063 - 75,954,996 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	75,947,063 - 75,954,996	NCBI
Celera	5	71,805,260 - 71,813,193 (-)	NCBI		Celera
Cytogenetic Map	5	q13.3	NCBI
HuRef	5	71,119,015 - 71,126,968 (-)	NCBI		HuRef
CHM1_1	5	75,344,295 - 75,352,247 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	77,097,223 - 77,105,145 (-)	NCBI		T2T-CHM13v2.0

F2rl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	95,833,428 - 95,839,276 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	95,833,361 - 95,839,247 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	95,696,920 - 95,702,768 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	95,696,853 - 95,702,739 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	96,466,875 - 96,472,723 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	96,797,656 - 96,803,438 (+)	NCBI		MGSCv36	mm8
Celera	13	99,313,808 - 99,319,652 (+)	NCBI		Celera
Cytogenetic Map	13	D1	NCBI
cM Map	13	50.38	NCBI

F2rl2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	24,246,333 - 24,254,887 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	24,246,333 - 24,254,887 (+)	NCBI	ChiLan1.0	ChiLan1.0

F2RL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	5	39,297,424 - 39,305,370 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	39,297,424 - 39,305,370 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	5	38,680,372 - 38,688,509 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

F2RL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	29,967,278 - 29,974,316 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	29,967,312 - 29,972,872 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	31,206,044 - 31,213,084 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	29,891,456 - 29,898,496 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	29,891,199 - 29,898,494 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	29,822,502 - 29,829,542 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	29,802,374 - 29,809,212 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	30,172,976 - 30,180,016 (+)	NCBI		UU_Cfam_GSD_1.0

F2rl2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	190,515,607 - 190,522,114 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936549	337,024 - 342,948 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936549	336,871 - 342,992 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

F2RL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	85,535,676 - 85,541,767 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	85,534,188 - 85,542,062 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	87,181,035 - 87,188,670 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

F2RL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	70,887,979 - 70,895,419 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	70,886,113 - 70,895,113 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666049	19,720,145 - 19,727,047 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

F2rl2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624869	1,073,656 - 1,077,635 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624869	1,073,481 - 1,078,207 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in F2rl2
37 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	32
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000024292
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631682	Bp115	Blood pressure QTL 115	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	1	37410502	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	41244106	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	7887772	42804738	Rat
738012	Anxrr3	Anxiety related response QTL 3	3.8		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	2	9023519	54023519	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	11852062	49003364	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat

Markers in Region

F2rl2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	26,975,969 - 26,976,089 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	26,244,405 - 26,244,524	NCBI	Rnor6.0
Rnor_5.0	2	45,375,800 - 45,375,919	UniSTS	Rnor5.0
Celera	2	23,037,850 - 23,037,969	UniSTS
Cytogenetic Map	2	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			12	4	3	4					1
Low	3	21	37	29	16	29	1	1	25	16	21	11	1
Below cutoff		22	6	6		6	7	9	41	19	17		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF310076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000024292 ⟹ ENSRNOP00000024292

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	26,972,054 - 26,977,098 (+)	Ensembl
Rnor_6.0 Ensembl	2	26,240,385 - 26,245,533 (+)	Ensembl

RefSeq Acc Id:

NM_053313 ⟹ NP_445765

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	26,972,054 - 26,977,098 (+)	NCBI
Rnor_6.0	2	26,240,385 - 26,245,533 (+)	NCBI
Rnor_5.0	2	45,371,780 - 45,376,928 (+)	NCBI
RGSC_v3.4	2	26,073,852 - 26,078,618 (+)	RGD
Celera	2	23,033,959 - 23,038,978 (+)	RGD

Sequence:

show sequence

TGAGGGGAATCTACCCTGTGTCTCTGCACACTTAGTGACATCCCATAACCGGGTCTCAAGACAT
GGAGATGAAAGTCCTTATCTTGGTTGGGGTTAGGCTGCTGTTTCTGCCGACCACTGTTTGCCAA
AGTGGCATGAAACATGTTTCAGACAACTCAGCCTTAACTGCTGAGAGTTTTAATGGCAACGAAC
ATTCCTTTGAAGAATTCCCACTTTCTGACATAGAGGGCTGGACAGGAGCCACCACAACTATAAA
AGCGAAGTGTCCCGAAGAAAGCATTACAACTCTCCATGTGAATAATGCTACCATGGGATACCTG
AGAAGTTCCTTAAGTACCAAAGTGATACCTGCCATCTACATCCTGGTGTTTGTGATTGGTGTAC
CAGCGAACATCGTGACCCTGTGGAAACTCTCCTCAAGGACCAAATCCATCTGTCTGGTCATCTT
TCACACCAACCTGGCCATCGCGGATCTCCTTTTCTGTGTCACGCTGCCGTTTAAGATCGCCTAC
CATCTCAATGGGAACGACTGGGTCTTTGGCGAGGTCATGTGCCGGGTCACCACGGTCGCTTTCT
ACGGCAACATGTATTGTGCTATTCTCATCCTCACCTGTATGGGCATCAACCGCTACCTGGCCAC
GGTCCATCCCTTCACATACCGCAAGCTGCCCAAACGCAACTTCACTTTGCTCATGTGTGGCGTG
GTGTGGGTCATGGTGGTCTTATATATGTTGCCGTTGGCCATCCTCAAGCAGGAGTACCATCTTG
TCCAACCAGGGATCACCACCTGCCACGACGTCCACGACACATGCGAGTCCCCGTTGCCCTTCCA
GTTCTACTACTTCGTCTCCTTGGCCTTCTTTGGGTTCCTTATCCCATTTGTGGTCAGTGTCTTC
TGTTACACGACTCTCATCCACAAGCTTAACGCGCAGGATCGCAAATGGCTGAGGTACATCAAGG
CGGTTCTCCTCATCCTTGTGATTTTCACCATCTGCTTTGCCCCCACCAACATCATACTCATAAT
TCACCACGCCAACTACTACTACAGCAACACTGATAGCTTGTACTTTATGTATCTCATAGCTCTC
TGCCTGGGCAGCCTGAATAGTTGCCTAGACCCATTCCTTTATTTTATCATGTCAAAAATTGTAG
ATCAGCTGACCTCGTAGTCAACAATGGCGAGATCATCTTGGAGAACAAGGATAGATATCTGGGG
GAAATGTATATGCTTGGGCTGACTTGTGCATGGTACCAACAGCTCAATTTTTAATCTTTAATTT
TAATTTTATGTTTTTTGAGGCAGGGTGTCACTATGTAGTCCTGGCTGGCCCGGAATTTTCTATT
TTTAGACTAGGTTGGCTTGAACTCATAGAGATCTGCCTGCTTCTGCCTCCCATCTGCTGGGGTC
AGCCAGACCTGGCCACCAGCTCCATTTTTAAGCTCCAATGAAATAGTACTTCACATATCAAATG
TAAAATTGTGGGGATTAAAAAAATACTTCACGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_445765	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL26789	(Get FASTA)	NCBI Sequence Viewer
	EDM10105	(Get FASTA)	NCBI Sequence Viewer
	Q920E1	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_445765 ⟸ NM_053313
- Peptide Label:	precursor
- UniProtKB:	Q920E1 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEMKVLILVGVRLLFLPTTVCQSGMKHVSDNSALTAESFNGNEHSFEEFPLSDIEGWTGATTTI KAKCPEESITTLHVNNATMGYLRSSLSTKVIPAIYILVFVIGVPANIVTLWKLSSRTKSICLVI FHTNLAIADLLFCVTLPFKIAYHLNGNDWVFGEVMCRVTTVAFYGNMYCAILILTCMGINRYLA TVHPFTYRKLPKRNFTLLMCGVVWVMVVLYMLPLAILKQEYHLVQPGITTCHDVHDTCESPLPF QFYYFVSLAFFGFLIPFVVSVFCYTTLIHKLNAQDRKWLRYIKAVLLILVIFTICFAPTNIILI IHHANYYYSNTDSLYFMYLIALCLGSLNSCLDPFLYFIMSKIVDQLTS hide sequence

RefSeq Acc Id:

ENSRNOP00000024292 ⟸ ENSRNOT00000024292

Protein Domains

G_PROTEIN_RECEP_F1_2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q920E1-F1-model_v2	AlphaFold	Q920E1	1-368	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691078

Promoter ID:

EPDNEW_R1603

Type:

initiation region

Name:

F2rl2_1

Description:

coagulation factor II receptor-like 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	26,240,363 - 26,240,423	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620871	AgrOrtholog
BioCyc Gene	G2FUF-54799	BioCyc
Ensembl Genes	ENSRNOG00000018054	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000024292	ENTREZGENE
	ENSRNOP00000024292.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024292	ENTREZGENE
	ENSRNOT00000024292.3	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_act_rcpt_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protea_act_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29636	UniProtKB/Swiss-Prot
NCBI Gene	29636	ENTREZGENE
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	F2rl2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEASEAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEASEAR3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	F1LPU1_RAT	UniProtKB/TrEMBL
	PAR3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	F2rl2	coagulation factor II (thrombin) receptor-like 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	F2rl2	coagulation factor II (thrombin) receptor-like 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)