Advanced Search (OLGA)

Gene: Fxyd3 (FXYD domain-containing ion transport regulator 3) Rattus norvegicus

Analyze

Symbol:

Fxyd3

Name:

FXYD domain-containing ion transport regulator 3

RGD ID:

620825

Description:

Predicted to enable ATPase binding activity and sodium channel regulator activity. Predicted to be involved in positive regulation of sodium ion export across plasma membrane. Predicted to act upstream of or within regulation of catalytic activity. Predicted to be located in endoplasmic reticulum membrane. Orthologous to human FXYD3 (FXYD domain containing ion transport regulator 3); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

MAT8; sodium/potassium-transporting ATPase subunit FXYD3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,432,918 - 95,440,129 (-)	NCBI		GRCr8
mRatBN7.2	1	86,305,531 - 86,312,455 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,725,977 - 91,732,756 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	100,192,123 - 100,198,914 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,484,253 - 93,491,042 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,502,561 - 89,510,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,502,562 - 89,509,343 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,656,769 - 90,664,514 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	86,113,706 - 86,120,488 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	86,191,817 - 86,195,198 (-)	NCBI
Celera	1	80,674,540 - 80,681,283 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fxyd3	Rat	Brugada syndrome 5		ISO	RGD:1348403	8554872	ClinVar Annotator: match by term: Brugada syndrome 5	ClinVar	PMID:28492532
Fxyd3	Rat	dystonia		ISO	RGD:1348403	8554872	ClinVar Annotator: match by term: Dystonic disorder	ClinVar	PMID:32581362
Fxyd3	Rat	hereditary spastic paraplegia 75		ISO	RGD:1348403	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 75	ClinVar	PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fxyd3	Rat	diastolic heart failure		ISO	RGD:1348403	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29556499
Fxyd3	Rat	pancreatic cancer		ISO	RGD:1348403	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16003754

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fxyd3	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1553033	6480464	Ethinyl Estradiol results in increased expression of FXYD3 mRNA	CTD	PMID:17942748
Fxyd3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1553033	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FXYD3 mRNA	CTD	PMID:17942748
Fxyd3	Rat	17beta-estradiol	affects expression	ISO	RGD:1553033	6480464	Estradiol affects the expression of FXYD3 mRNA	CTD	PMID:15598610
Fxyd3	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FXYD3 mRNA	CTD	PMID:32741896
Fxyd3	Rat	17beta-estradiol	increases expression	ISO	RGD:1553033	6480464	Estradiol results in increased expression of FXYD3 mRNA	CTD	PMID:15289156\|PMID:19484750
Fxyd3	Rat	17beta-estradiol	decreases expression	ISO	RGD:1348403	6480464	Estradiol results in decreased expression of FXYD3 mRNA	CTD	PMID:24758408
Fxyd3	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1348403	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of FXYD3 mRNA; EGF protein promotes more ...	CTD	PMID:24758408\|PMID:30165855
Fxyd3	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FXYD3 mRNA	CTD	PMID:32741896
Fxyd3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1553033	6480464	Tetrachlorodibenzodioxin results in increased expression of FXYD3 mRNA	CTD	PMID:17942748
Fxyd3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of FXYD3 mRNA	CTD	PMID:33387578
Fxyd3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FXYD3 mRNA	CTD	PMID:32109520
Fxyd3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1553033	6480464	Tetrachlorodibenzodioxin affects the expression of FXYD3 mRNA	CTD	PMID:21570461
Fxyd3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1553033	6480464	Tetrachlorodibenzodioxin results in decreased expression of FXYD3 mRNA	CTD	PMID:21354282
Fxyd3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1553033	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FXYD3 mRNA	CTD	PMID:17942748
Fxyd3	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1553033	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of FXYD3 mRNA	CTD	PMID:38648751
Fxyd3	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1348403	6480464	bisphenol S results in decreased methylation of FXYD3 gene	CTD	PMID:31601247
Fxyd3	Rat	4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one	multiple interactions	ISO	RGD:1348403	6480464	[Benzo(a)pyrene co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of FXYD3 mRNA	CTD	PMID:20146248
Fxyd3	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1553033	6480464	Fenretinide results in decreased expression of FXYD3 mRNA	CTD	PMID:28973697
Fxyd3	Rat	5-fluorouracil	increases expression	ISO	RGD:1348403	6480464	Fluorouracil results in increased expression of FXYD3 mRNA	CTD	PMID:15152939
Fxyd3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of FXYD3 mRNA	CTD	PMID:24780913\|PMID:30047161
Fxyd3	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of FXYD3 mRNA	CTD	PMID:31881176
Fxyd3	Rat	actinomycin D	multiple interactions	ISO	RGD:1348403	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FXYD3 mRNA	CTD	PMID:38460933
Fxyd3	Rat	actinomycin D	increases expression	ISO	RGD:1348403	6480464	Dactinomycin results in increased expression of FXYD3 mRNA	CTD	PMID:38460933
Fxyd3	Rat	aflatoxin B1	increases expression	ISO	RGD:1348403	6480464	Aflatoxin B1 results in increased expression of FXYD3 mRNA	CTD	PMID:22100608\|PMID:32234424
Fxyd3	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of FXYD3 mRNA	CTD	PMID:22484513\|PMID:23630614
Fxyd3	Rat	all-trans-retinoic acid	affects expression	ISO	RGD:1348403	6480464	Tretinoin affects the expression of FXYD3 mRNA	CTD	PMID:31600526
Fxyd3	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1553033	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of FXYD3 mRNA	CTD	PMID:30951980
Fxyd3	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of FXYD3 mRNA	CTD	PMID:30047161
Fxyd3	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of FXYD3 mRNA	CTD	PMID:16483693
Fxyd3	Rat	amphotericin B	increases expression	ISO	RGD:1348403	6480464	Amphotericin B analog results in increased expression of FXYD3 mRNA	CTD	PMID:28534445
Fxyd3	Rat	Azoxymethane	multiple interactions	ISO	RGD:1553033	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FXYD3 more ...	CTD	PMID:29950665
Fxyd3	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1348403	6480464	[Benzo(a)pyrene co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of FXYD3 mRNA	CTD	PMID:20146248
Fxyd3	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1348403	6480464	Benzo(a)pyrene results in increased expression of FXYD3 mRNA	CTD	PMID:32234424
Fxyd3	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1348403	6480464	Benzo(a)pyrene affects the methylation of FXYD3 3' UTR	CTD	PMID:27901495
Fxyd3	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1348403	6480464	Benzo(a)pyrene results in decreased methylation of FXYD3 5' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
Fxyd3	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1553033	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of FXYD3 mRNA]	CTD	PMID:22228805
Fxyd3	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1553033	6480464	Benzo(a)pyrene results in decreased expression of FXYD3 mRNA	CTD	PMID:22228805
Fxyd3	Rat	bisphenol A	decreases expression	ISO	RGD:1553033	6480464	bisphenol A results in decreased expression of FXYD3 mRNA	CTD	PMID:26063408
Fxyd3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FXYD3 mRNA	CTD	PMID:36779543
Fxyd3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FXYD3 mRNA	CTD	PMID:25181051\|PMID:33296240
Fxyd3	Rat	bisphenol F	multiple interactions	ISO	RGD:1553033	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of FXYD3 mRNA	CTD	PMID:30951980
Fxyd3	Rat	bisphenol F	decreases expression	ISO	RGD:1553033	6480464	bisphenol F results in decreased expression of FXYD3 mRNA	CTD	PMID:38685157
Fxyd3	Rat	bisphenol F	increases expression	ISO	RGD:1553033	6480464	bisphenol F results in increased expression of FXYD3 mRNA	CTD	PMID:30951980
Fxyd3	Rat	cadmium dichloride	increases expression	ISO	RGD:1348403	6480464	Cadmium Chloride results in increased expression of FXYD3 mRNA	CTD	PMID:26472689
Fxyd3	Rat	cadmium dichloride	decreases expression	ISO	RGD:1348403	6480464	Cadmium Chloride results in decreased expression of FXYD3 mRNA	CTD	PMID:38382870
Fxyd3	Rat	caffeine	increases phosphorylation	ISO	RGD:1348403	6480464	Caffeine results in increased phosphorylation of FXYD3 protein	CTD	PMID:35688186
Fxyd3	Rat	calcitriol	multiple interactions	ISO	RGD:1348403	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of FXYD3 mRNA	CTD	PMID:21592394
Fxyd3	Rat	calcitriol	increases expression	ISO	RGD:1348403	6480464	Calcitriol results in increased expression of FXYD3 mRNA	CTD	PMID:21592394\|PMID:26485663
Fxyd3	Rat	camptothecin	increases expression	ISO	RGD:1348403	6480464	Camptothecin results in increased expression of FXYD3 mRNA	CTD	PMID:38460933
Fxyd3	Rat	choline	multiple interactions	ISO	RGD:1553033	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fxyd3	Rat	chrysene	increases expression	ISO	RGD:1553033	6480464	chrysene results in increased expression of FXYD3 mRNA	CTD	PMID:26377693
Fxyd3	Rat	cisplatin	multiple interactions	ISO	RGD:1348403	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of FXYD3 mRNA	CTD	PMID:27392435
Fxyd3	Rat	cisplatin	increases expression	ISO	RGD:1348403	6480464	Cisplatin results in increased expression of FXYD3 mRNA	CTD	PMID:27392435
Fxyd3	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of FXYD3 mRNA	CTD	PMID:24386269
Fxyd3	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of FXYD3 mRNA	CTD	PMID:26577399\|PMID:27523638
Fxyd3	Rat	dextran sulfate	multiple interactions	ISO	RGD:1553033	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FXYD3 more ...	CTD	PMID:29950665
Fxyd3	Rat	diethyl phthalate	decreases expression	EXP		6480464	diethyl phthalate results in decreased expression of FXYD3 mRNA	CTD	PMID:32341500
Fxyd3	Rat	diethylstilbestrol	increases expression	ISO	RGD:1553033	6480464	Diethylstilbestrol results in increased expression of FXYD3 mRNA	CTD	PMID:15289156
Fxyd3	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of FXYD3 mRNA	CTD	PMID:36653537
Fxyd3	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of FXYD3 mRNA	CTD	PMID:21551480
Fxyd3	Rat	folic acid	multiple interactions	ISO	RGD:1553033	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fxyd3	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of FXYD3 mRNA	CTD	PMID:27387713
Fxyd3	Rat	gemcitabine	increases expression	ISO	RGD:1348403	6480464	Gemcitabine results in increased expression of FXYD3 mRNA	CTD	PMID:17039268
Fxyd3	Rat	genistein	increases expression	ISO	RGD:1553033	6480464	Genistein results in increased expression of FXYD3 mRNA	CTD	PMID:15289156
Fxyd3	Rat	genistein	decreases expression	ISO	RGD:1553033	6480464	Genistein results in decreased expression of FXYD3 mRNA	CTD	PMID:32186404
Fxyd3	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of FXYD3 mRNA	CTD	PMID:33387578
Fxyd3	Rat	ICI D1694	increases expression	ISO	RGD:1348403	6480464	raltitrexed results in increased expression of FXYD3 mRNA	CTD	PMID:15152939
Fxyd3	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of FXYD3 mRNA	CTD	PMID:21396975
Fxyd3	Rat	irinotecan	increases expression	ISO	RGD:1348403	6480464	Irinotecan results in increased expression of FXYD3 mRNA	CTD	PMID:15152939
Fxyd3	Rat	L-methionine	multiple interactions	ISO	RGD:1553033	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fxyd3	Rat	medroxyprogesterone acetate	increases expression	ISO	RGD:1348403	6480464	Medroxyprogesterone Acetate results in increased expression of FXYD3 mRNA	CTD	PMID:18497975
Fxyd3	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of FXYD3 mRNA	CTD	PMID:30047161
Fxyd3	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of FXYD3 mRNA	CTD	PMID:28943392
Fxyd3	Rat	nickel atom	multiple interactions	ISO	RGD:1348403	6480464	trichostatin A inhibits the reaction [Nickel affects the expression of FXYD3 mRNA]	CTD	PMID:14575637
Fxyd3	Rat	nickel atom	affects expression	ISO	RGD:1348403	6480464	Nickel affects the expression of FXYD3 mRNA	CTD	PMID:14575637
Fxyd3	Rat	Nutlin-3	multiple interactions	ISO	RGD:1348403	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FXYD3 mRNA	CTD	PMID:38460933
Fxyd3	Rat	okadaic acid	decreases expression	ISO	RGD:1348403	6480464	Okadaic Acid results in decreased expression of FXYD3 mRNA	CTD	PMID:38832940
Fxyd3	Rat	oxaliplatin	increases expression	ISO	RGD:1348403	6480464	oxaliplatin results in increased expression of FXYD3 mRNA	CTD	PMID:15152939
Fxyd3	Rat	ozone	multiple interactions	ISO	RGD:1553033	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Fxyd3	Rat	paclitaxel	increases response to substance	ISO	RGD:1348403	6480464	FXYD3 mRNA results in increased susceptibility to Paclitaxel	CTD	PMID:16322897
Fxyd3	Rat	paclitaxel	decreases expression	ISO	RGD:1348403	6480464	Paclitaxel results in decreased expression of FXYD3 mRNA	CTD	PMID:19682730
Fxyd3	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of FXYD3 mRNA	CTD	PMID:33387578
Fxyd3	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of FXYD3 mRNA	CTD	PMID:32680482
Fxyd3	Rat	poly(I:C)	multiple interactions	EXP		6480464	[Poly I-C co-treated with HU 211] results in increased expression of FXYD3 mRNA	CTD	PMID:26923065
Fxyd3	Rat	progesterone	increases expression	ISO	RGD:1348403	6480464	Progesterone results in increased expression of FXYD3 mRNA	CTD	PMID:18497975
Fxyd3	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of FXYD3 mRNA	CTD	PMID:19013527
Fxyd3	Rat	S-nitrosoglutathione	decreases expression	ISO	RGD:1348403	6480464	S-Nitrosoglutathione results in decreased expression of FXYD3 mRNA	CTD	PMID:38825487
Fxyd3	Rat	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide results in increased expression of FXYD3 mRNA	CTD	PMID:22431001
Fxyd3	Rat	sodium arsenite	decreases expression	ISO	RGD:1348403	6480464	sodium arsenite results in decreased expression of FXYD3 mRNA	CTD	PMID:38568856
Fxyd3	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of FXYD3 mRNA	CTD	PMID:30047161
Fxyd3	Rat	testosterone	multiple interactions	ISO	RGD:1348403	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of FXYD3 mRNA	CTD	PMID:21592394
Fxyd3	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FXYD3 mRNA	CTD	PMID:32741896
Fxyd3	Rat	testosterone	increases expression	ISO	RGD:1348403	6480464	Testosterone results in increased expression of FXYD3 mRNA	CTD	PMID:21592394
Fxyd3	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of FXYD3 mRNA	CTD	PMID:33387578
Fxyd3	Rat	thioacetamide	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of FXYD3 mRNA	CTD	PMID:28943392
Fxyd3	Rat	titanium dioxide	multiple interactions	ISO	RGD:1553033	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FXYD3 more ...	CTD	PMID:29950665
Fxyd3	Rat	titanium dioxide	decreases expression	ISO	RGD:1553033	6480464	titanium dioxide results in decreased expression of FXYD3 mRNA	CTD	PMID:35295148
Fxyd3	Rat	toluene	decreases expression	EXP		6480464	Toluene results in decreased expression of FXYD3 mRNA	CTD	PMID:22967744
Fxyd3	Rat	trichostatin A	multiple interactions	ISO	RGD:1348403	6480464	trichostatin A inhibits the reaction [Nickel affects the expression of FXYD3 mRNA]	CTD	PMID:14575637
Fxyd3	Rat	trichostatin A	increases expression	ISO	RGD:1348403	6480464	trichostatin A results in increased expression of FXYD3 mRNA	CTD	PMID:24935251
Fxyd3	Rat	valproic acid	increases expression	ISO	RGD:1348403	6480464	Valproic Acid results in increased expression of FXYD3 mRNA	CTD	PMID:24935251
Fxyd3	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of FXYD3 mRNA	CTD	PMID:29427782
Fxyd3	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of FXYD3 mRNA	CTD	PMID:19015723

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fxyd3	Rat	monoatomic ion transport		NAS		632671		RGD
Fxyd3	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fxyd3	Rat	positive regulation of sodium ion export across plasma membrane	involved_in	IBA	MGI:1889273\|PANTHER:PTN000364858\|UniProtKB:Q3SZX0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fxyd3	Rat	potassium ion transport	involved_in	IEA	UniProtKB-KW:KW-0633\|UniProtKB-KW:KW-0740	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fxyd3	Rat	regulation of catalytic activity	acts_upstream_of_or_within	ISO	RGD:1553033	1624291	PMID:15743908	RGD	PMID:15743908
Fxyd3	Rat	regulation of monoatomic ion transport	involved_in	IEA	InterPro:IPR000272	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fxyd3	Rat	sodium ion transport	involved_in	IEA	UniProtKB-KW:KW-0739\|UniProtKB-KW:KW-0740	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fxyd3	Rat	endoplasmic reticulum membrane	located_in	ISO	RGD:1553033	1624291	PMID:15743908	RGD	PMID:15743908
Fxyd3	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q61835\|ensembl:ENSMUSP00000130245	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fxyd3	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fxyd3	Rat	membrane	located_in	IEA	InterPro:IPR000272	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fxyd3	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fxyd3	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fxyd3	Rat	ATPase binding	enables	IEA	UniProtKB:Q61835\|ensembl:ENSMUSP00000130245	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fxyd3	Rat	ATPase binding	enables	ISO	RGD:1553033	1624291	UniProtKB:P06685\|UniProtKB:P07340\|UniProtKB:Q63252 PMID:15743908	RGD	PMID:15743908
Fxyd3	Rat	ion channel regulator activity	enables	IEA	InterPro:IPR000272	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fxyd3	Rat	protein binding	enables	ISO	RGD:1348403,UniProtKB:Q14802-3	1624291	UniProtKB:O14925\|UniProtKB:O15529\|UniProtKB:O15552\|UniProtKB:O15554\|UniProtKB:O43315\|UniProtKB:O43934\|UniProtKB:O60883\|UniProtKB:O95470\|UniProtKB:P00387\|UniProtKB:P0DN84\|UniProtKB:P10620\|UniProtKB:P11912\|UniProtKB:P12318-2\|UniProtKB:P16157-17\|UniProtKB:P21815\|UniProtKB:P34972\|UniProtKB:P43005\|UniProtKB:P54219-3\|UniProtKB:P55061\|UniProtKB:P56557\|UniProtKB:P78382\|UniProtKB:P78383\|UniProtKB:Q13277\|UniProtKB:Q13520\|UniProtKB:Q14973\|UniProtKB:Q15125\|UniProtKB:Q16873\|UniProtKB:Q3KNW5\|UniProtKB:Q4KMG9\|UniProtKB:Q5BJF2\|UniProtKB:Q5JX71\|UniProtKB:Q5TGU0\|UniProtKB:Q6N075\|UniProtKB:Q6ZMD2-2\|UniProtKB:Q6ZSM3\|UniProtKB:Q7Z7N9\|UniProtKB:Q8IY26\|UniProtKB:Q8N2M4\|UniProtKB:Q8N6L0\|UniProtKB:Q8NFU1\|UniProtKB:Q8TD06\|UniProtKB:Q8TDT2\|UniProtKB:Q96BA8\|UniProtKB:Q96CP7\|UniProtKB:Q96HE8\|UniProtKB:Q9BRI3\|UniProtKB:Q9BXK5\|UniProtKB:Q9H2K0\|UniProtKB:Q9H3K2\|UniProtKB:Q9NP94\|UniProtKB:Q9NPL8\|UniProtKB:Q9NQQ7-3\|UniProtKB:Q9NY72\|UniProtKB:Q9NZD1\|UniProtKB:Q9UKR5\|UniProtKB:Q9Y282 PMID:32296183	RGD	PMID:32296183
Fxyd3	Rat	protein binding	enables	ISO	RGD:1553033	1624291	UniProtKB:P12336\|UniProtKB:P41181 PMID:15743908	RGD	PMID:15743908
Fxyd3	Rat	sodium channel regulator activity	enables	IBA	MGI:1195260\|MGI:1201785\|MGI:1889273\|PANTHER:PTN000364858\|RGD:70998\|UniProtKB:P56513\|UniProtKB:Q96DB9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Disease Annotations Click to see Annotation Detail View

Brugada syndrome 5 (ISO)

diastolic heart failure (ISO)

dystonia (ISO)

hereditary spastic paraplegia 75 (ISO)

pancreatic cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphotericin B (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

camptothecin (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

Cuprizon (EXP)

dextran sulfate (ISO)

diethyl phthalate (EXP)

diethylstilbestrol (EXP,ISO)

diuron (EXP)

folic acid (ISO)

furan (EXP)

gemcitabine (ISO)

genistein (ISO)

gentamycin (EXP)

ICI D1694 (ISO)

indole-3-methanol (EXP)

irinotecan (ISO)

L-methionine (ISO)

medroxyprogesterone acetate (ISO)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

oxaliplatin (ISO)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP)

paraquat (EXP)

poly(I:C) (EXP)

progesterone (ISO)

rotenone (EXP)

S-nitrosoglutathione (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

testosterone (EXP,ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

trichostatin A (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

monoatomic ion transport (IEA,NAS)

positive regulation of sodium ion export across plasma membrane (IBA)

potassium ion transport (IEA)

regulation of catalytic activity (ISO)

regulation of monoatomic ion transport (IEA)

sodium ion transport (IEA)

Cellular Component

endoplasmic reticulum membrane (IEA,ISO)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

ATPase binding (IEA,ISO)

ion channel regulator activity (IEA)

protein binding (ISO)

sodium channel regulator activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	The FXYD gene family of small ion transport regulators or channels: cDNA sequence, protein signature sequence, and expression.	Sweadner KJ and Rael E, Genomics 2000 Aug 15;68(1):41-56.

Additional References at PubMed

PMID:15743908	PMID:19199708

Genomics

Comparative Map Data

Fxyd3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,432,918 - 95,440,129 (-)	NCBI		GRCr8
mRatBN7.2	1	86,305,531 - 86,312,455 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,725,977 - 91,732,756 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	100,192,123 - 100,198,914 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,484,253 - 93,491,042 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,502,561 - 89,510,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,502,562 - 89,509,343 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,656,769 - 90,664,514 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	86,113,706 - 86,120,488 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	86,191,817 - 86,195,198 (-)	NCBI
Celera	1	80,674,540 - 80,681,283 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

FXYD3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,115,823 - 35,124,324 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,115,823 - 35,124,324 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	35,606,727 - 35,615,228 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	40,298,639 - 40,307,067 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	40,298,638 - 40,307,067	NCBI
Celera	19	32,320,104 - 32,328,664 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,114,660 - 32,123,221 (+)	NCBI		HuRef
CHM1_1	19	35,608,738 - 35,617,241 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	37,660,439 - 37,669,003 (+)	NCBI		T2T-CHM13v2.0

Fxyd3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,769,960 - 30,776,122 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,767,597 - 30,776,129 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	31,070,535 - 31,076,697 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	31,068,172 - 31,076,704 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,855,554 - 31,861,716 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,779,297 - 30,785,432 (-)	NCBI		MGSCv36	mm8
Celera	7	25,637,243 - 25,643,391 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	19.29	NCBI

Fxyd3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	4,436,334 - 4,444,315 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	4,437,280 - 4,444,315 (+)	NCBI	ChiLan1.0	ChiLan1.0

FXYD3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,103,312 - 41,135,936 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,086,656 - 43,119,266 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,036,936 - 32,070,374 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	40,775,323 - 40,808,664 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

FXYD3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	117,452,952 - 117,459,632 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	117,453,272 - 117,456,193 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,853,609 - 116,860,236 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	118,050,547 - 118,057,103 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	118,050,867 - 118,053,788 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	117,613,152 - 117,619,696 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	117,238,490 - 117,245,100 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	118,294,967 - 118,301,602 (-)	NCBI		UU_Cfam_GSD_1.0

Fxyd3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	10,507,840 - 10,513,697 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	1,132,150 - 1,138,146 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	1,132,185 - 1,137,676 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FXYD3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	44,647,466 - 44,654,374 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	44,647,771 - 44,654,377 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,111,472 - 40,118,054 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FXYD3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,047,352 - 30,057,059 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,052,066 - 30,056,026 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	7,822,361 - 7,830,410 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fxyd3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	8,385,138 - 8,391,670 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	8,385,138 - 8,391,723 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fxyd3
26 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	168
Count of miRNA genes:	121
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000028637
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Markers in Region

BE120691

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,305,694 - 86,305,887 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,502,725 - 89,502,917	NCBI	Rnor6.0
Rnor_5.0	1	90,657,815 - 90,658,007	UniSTS	Rnor5.0
RGSC_v3.4	1	86,113,870 - 86,114,062	UniSTS	RGSC3.4
Celera	1	80,674,704 - 80,674,896	UniSTS
RH 3.4 Map	1	843.6	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	49	88	90	89	58	25	58	6	213	97	68	45	56	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW142066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG373727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA505583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY471861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028637 ⟹ ENSRNOP00000028637

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	89,502,562 - 89,509,343 (-)	Ensembl

RefSeq Acc Id:

NM_172317 ⟹ NP_758528

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,432,918 - 95,439,702 (-)	NCBI
mRatBN7.2	1	86,305,531 - 86,312,319 (-)	NCBI
Rnor_6.0	1	89,502,561 - 89,509,343 (-)	NCBI
Rnor_5.0	1	90,656,769 - 90,664,514 (-)	NCBI
RGSC_v3.4	1	86,113,706 - 86,120,488 (-)	RGD
Celera	1	80,674,540 - 80,681,283 (-)	RGD

Sequence:

show sequence

CCTGTTGAGCTACTCAGGTCAACGCTGACATGCAAGAGTTTGCTCTGAGCCTGTTGGTCCTTCT
AGCAGGCCTGCCTACTTTGGATGCCAATGACCCTGAAGATAAAGATAGCCCTTTCTACTATGAT
TGGCACAGCCTCCGAGTCGGCGGGCTCATCTGTGCAGGGATTCTCTGTGCCCTGGGCATTATAG
TTCTCATGAGTGGCAAGTGCAAATGCAAGTTCAGCCAGAAACCCAGCCACCGTCCAGGAGATGG
GCCACCCCTCATCACACCAGGCTCTGCTCACAACTGCTGAGGATGGATCAGTTAAAAAAGTGCA
GGTCCTGTCTCTGGAGATGGGCTTGAACTCCAAGATGTCTGGGCTCCTCCTCTCCTGACACTGC
CTTCCCCGAGCCTCATCTCATGGTAGCAGGTTCTTTGTTCAGTTGTTAATATAAAATGATTTTA
CGTCAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006228819 ⟹ XP_006228881

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,432,918 - 95,440,037 (-)	NCBI
mRatBN7.2	1	86,305,531 - 86,312,455 (-)	NCBI
Rnor_6.0	1	89,502,561 - 89,510,146 (-)	NCBI
Rnor_5.0	1	90,656,769 - 90,664,514 (-)	NCBI

Sequence:

show sequence

ATCCACACCCACACCCACTGGGTTTGCTCAGGGCGTGGCGGTGTGGATAAAGGCTGCCCTGGCT
TGGGAGTCCATACTCTGCTTTCTCCCGGAACCTCGAAGCCTGTTGAGCTACTCAGGTCAACGCT
GACATGCAAGAGTTTGCTCTGAGCCTGTTGGTCCTTCTAGCAGGCCTGCCTACTTTGGATGCCA
ATGACCCTGAAGATAAAGATAGCCCTTTCTACTATGATTGGCACAGCCTCCGAGTCGGCGGGCT
CATCTGTGCAGGGATTCTCTGTGCCCTGGGCATTATAGTTCTCATGAGTGGCAAGTGCAAATGC
AAGTTCAGCCAGAAACCCAGCCACCGTCCAGGAGATGGGCCACCCCTCATCACACCAGGTATGA
CACAGGATGATTGGGGGTGACACGTGGGGGTAATGGTCACTAGTGGAAGCTGGAGTGGGAGCGT
GCCTGAGTCAGGGAGAAGGAAAGGGGAGATGCTTGCAAACTGACTCCATTCCCTCTACCAGGCT
CTGCTCACAACTGCTGAGGATGGATCAGTTAAAAAAGTGCAGGTCCTGTCTCTGGAGATGGGCT
TGAACTCCAAGATGTCTGGGCTCCTCCTCTCCTGACACTGCCTTCCCCGAGCCTCATCTCATGG
TAGCAGGTTCTTTGTTCAGTTGTTAATATAAAATGATTTTACGTCA

hide sequence

RefSeq Acc Id:

XM_063266111 ⟹ XP_063122181

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,432,918 - 95,440,129 (-)	NCBI

RefSeq Acc Id:

XM_063266144 ⟹ XP_063122214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,432,918 - 95,440,078 (-)	NCBI

RefSeq Acc Id:

XM_063266166 ⟹ XP_063122236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,432,918 - 95,440,129 (-)	NCBI

RefSeq Acc Id:

XM_063266203 ⟹ XP_063122273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,432,918 - 95,440,038 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_758528	(Get FASTA)	NCBI Sequence Viewer
	XP_006228881	(Get FASTA)	NCBI Sequence Viewer
	XP_063122181	(Get FASTA)	NCBI Sequence Viewer
	XP_063122214	(Get FASTA)	NCBI Sequence Viewer
	XP_063122236	(Get FASTA)	NCBI Sequence Viewer
	XP_063122273	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM07666	(Get FASTA)	NCBI Sequence Viewer
	EDM07667	(Get FASTA)	NCBI Sequence Viewer
	EDM07668	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000104598
GenBank Protein	P59645	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_758528 ⟸ NM_172317
- Peptide Label:	precursor
- UniProtKB:	P59645 (UniProtKB/Swiss-Prot), A6JA66 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQEFALSLLVLLAGLPTLDANDPEDKDSPFYYDWHSLRVGGLICAGILCALGIIVLMSGKCKCK FSQKPSHRPGDGPPLITPGSAHNC hide sequence

RefSeq Acc Id:	XP_006228881 ⟸ XM_006228819
- Peptide Label:	isoform X1
- Sequence:	show sequence MQEFALSLLVLLAGLPTLDANDPEDKDSPFYYDWHSLRVGGLICAGILCALGIIVLMSGKCKCK FSQKPSHRPGDGPPLITPGMTQDDWG hide sequence

Ensembl Acc Id:

ENSRNOP00000028637 ⟸ ENSRNOT00000028637

RefSeq Acc Id:	XP_063122236 ⟸ XM_063266166
- Peptide Label:	isoform X2
- UniProtKB:	P59645 (UniProtKB/Swiss-Prot), A6JA66 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122181 ⟸ XM_063266111
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063122214 ⟸ XM_063266144
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063122273 ⟸ XM_063266203
- Peptide Label:	isoform X2
- UniProtKB:	P59645 (UniProtKB/Swiss-Prot), A6JA66 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P59645-F1-model_v2	AlphaFold	P59645	1-88	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689944

Promoter ID:

EPDNEW_R469

Type:

multiple initiation site

Name:

Fxyd3_1

Description:

FXYD domain-containing ion transport regulator 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	89,509,370 - 89,509,430	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620825	AgrOrtholog
BioCyc Gene	G2FUF-60047	BioCyc
Ensembl Genes	ENSRNOG00000021095	Ensembl
	ENSRNOG00000080106	ENTREZGENE
Ensembl Transcript	ENSRNOT00000172857	ENTREZGENE
Gene3D-CATH	Single helix bin	UniProtKB/Swiss-Prot
InterPro	FXYD_motif	UniProtKB/Swiss-Prot
	Ion-transport_regulator_FXYD	UniProtKB/Swiss-Prot
KEGG Report	rno:116831	UniProtKB/Swiss-Prot
NCBI Gene	116831	ENTREZGENE
PANTHER	FXYD DOMAIN-CONTAINING ION TRANSPORT REGULATOR 3	UniProtKB/Swiss-Prot
	SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT GAMMA	UniProtKB/Swiss-Prot
Pfam	ATP1G1_PLM_MAT8	UniProtKB/Swiss-Prot
PhenoGen	Fxyd3	PhenoGen
PROSITE	FXYD	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021095	RatGTEx
	ENSRNOG00000080106	RatGTEx
UniProt	A6JA66	ENTREZGENE, UniProtKB/TrEMBL
	A6JA68_RAT	UniProtKB/TrEMBL
	FXYD3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Fxyd3	FXYD domain-containing ion transport regulator 3			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Fxyd3	FXYD domain-containing ion transport regulator 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD