Gng5 (G protein subunit gamma 5) - Rat Genome Database

Name: Gng5
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gng5 (G protein subunit gamma 5) Rattus norvegicus

Analyze

Symbol:

Gng5

Name:

G protein subunit gamma 5 (Ensembl:guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5)

RGD ID:

620807

Description:

Predicted to enable G-protein beta-subunit binding activity and PDZ domain binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to act upstream of or within positive regulation of neural precursor cell proliferation and positive regulation of secondary heart field cardioblast proliferation. Part of G-protein beta/gamma-subunit complex. Orthologous to human GNG5 (G protein subunit gamma 5); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein gamma-5 subunit; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide binding protein (G protein), gamma 5 subunit; guanine nucleotide binding protein gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNG5 (G protein subunit gamma 5)	RGD	RGD
Mus musculus (house mouse):	Gng5 (G protein subunit gamma 5)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNG5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNG5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNG5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103236336 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GNG5 (G protein subunit gamma 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Gng5 (G protein subunit gamma 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gng5 (guanine nucleotide binding protein (G protein), gamma 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ggamma1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG43324	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)

Related Pseudogenes:

Gng5-ps3 Gng5-ps4 Gng5-ps5

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	235,394,680 - 235,403,177 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,292,043 - 77,292,513 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	243,190,418 - 243,198,920 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	241,081,826 - 241,090,324 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	235,948,055 - 235,956,557 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	252,359,976 - 252,368,473 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	252,359,976 - 252,368,473 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,886,941 - 270,895,438 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	244,702,876 - 244,711,373 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	244,689,615 - 244,698,113 (+)	NCBI
Celera	2	227,374,391 - 227,382,888 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

chlormequat chloride (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

daidzein (ISO)

daidzein 7-O-beta-D-glucoside (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP,ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (EXP)

folic acid (ISO)

genistein (EXP,ISO)

genistein 7-O-beta-D-glucoside (ISO)

glycitein (ISO)

glycitin (ISO)

hydrazine (ISO)

indometacin (ISO)

ivermectin (ISO)

maneb (ISO)

methidathion (ISO)

ochratoxin A (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

pentachlorophenol (ISO)

phenethyl isothiocyanate (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

procymidone (EXP)

sodium arsenite (ISO)

Soman (EXP)

tolcapone (EXP)

toluene (EXP)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

G protein-coupled receptor signaling pathway (IBA)

positive regulation of neural precursor cell proliferation (ISO)

positive regulation of secondary heart field cardioblast proliferation (ISO)

Cellular Component

cellular_component (ND)

G-protein beta/gamma-subunit complex (IDA)

heterotrimeric G-protein complex (IEA)

Molecular Function

G-protein beta-subunit binding (IBA)

molecular_function (ND)

PDZ domain binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	The heterotrimeric G protein subunits Galpha(q) and Gbeta(1) have lysophospholipase D activity.	Aoyama C, etal., Biochem J. 2011 Dec 1;440(2):241-50. doi: 10.1042/BJ20110545.
2.	Characterization of the cDNA and genomic sequence of a G protein gamma subunit (gamma 5).	Fisher KJ and Aronson NN Jr, Mol Cell Biol 1992 Apr;12(4):1585-91.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Information Derived from GenBank Report	RGD, Sept. 2003
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18614015	PMID:19056867	PMID:19946888	PMID:20458337	PMID:23209302	PMID:23376485	PMID:24599258

Genomics

Comparative Map Data

Gng5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	235,394,680 - 235,403,177 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,292,043 - 77,292,513 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	243,190,418 - 243,198,920 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	241,081,826 - 241,090,324 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	235,948,055 - 235,956,557 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	252,359,976 - 252,368,473 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	252,359,976 - 252,368,473 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,886,941 - 270,895,438 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	244,702,876 - 244,711,373 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	244,689,615 - 244,698,113 (+)	NCBI
Celera	2	227,374,391 - 227,382,888 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

GNG5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	84,498,325 - 84,506,581 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	84,498,323 - 84,506,581 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	84,964,008 - 84,972,264 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	84,736,680 - 84,744,831 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	84,676,112 - 84,684,264	NCBI
Celera	1	83,208,179 - 83,216,434 (-)	NCBI		Celera
Cytogenetic Map	1	p22.3	NCBI
HuRef	1	83,074,217 - 83,082,472 (-)	NCBI		HuRef
CHM1_1	1	85,078,836 - 85,087,091 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	84,338,707 - 84,346,962 (-)	NCBI		T2T-CHM13v2.0

Gng5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	146,205,591 - 146,211,298 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	146,205,562 - 146,211,327 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	146,499,836 - 146,505,543 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	146,499,807 - 146,505,572 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	146,162,800 - 146,168,507 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	146,437,222 - 146,442,929 (+)	NCBI		MGSCv36	mm8
MGSCv36	2	22,592,270 - 22,592,755 (-)	NCBI		MGSCv36	mm8
Celera	3	152,950,022 - 152,955,729 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI

Gng5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955423	9,388,501 - 9,393,287 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNG5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	85,907,523 - 85,915,899 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	1	117,046,699 - 117,055,097 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GNG5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	63,389,991 - 63,398,797 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	3,966,947 - 3,967,377 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	66,036,986 - 66,045,291 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	63,928,353 - 63,936,839 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	63,846,818 - 63,936,830 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	63,456,623 - 63,464,915 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	63,425,333 - 63,433,644 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	63,931,297 - 63,939,608 (+)	NCBI		UU_Cfam_GSD_1.0

Gng5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	95,195,921 - 95,203,713 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936608	1,102,140 - 1,110,116 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936608	1,102,140 - 1,110,116 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	129,247,324 - 129,254,973 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103236336
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	92,726,766 - 92,728,028 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	72,407,737 - 72,408,252 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	12,969,251 - 12,977,417 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	12,969,229 - 12,977,367 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gng5
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	314
Count of miRNA genes:	179
Interacting mature miRNAs:	210
Transcripts:	ENSRNOT00000021358
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	229059610	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
9587428	Epfw6	Epididymal fat weight QTL 6	7.47	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	2	223389739	249053267	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7411555	Bw132	Body weight QTL 132		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	223389739	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat

Markers in Region

AA859354

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	44,627,255 - 44,627,438 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	47,090,201 - 47,090,383	NCBI	Rnor6.0
Rnor_5.0	11	50,272,091 - 50,272,273	UniSTS	Rnor5.0
RGSC_v3.4	11	45,602,158 - 45,602,340	UniSTS	RGSC3.4
Celera	11	44,377,761 - 44,377,943	UniSTS
RH 3.4 Map	11	332.4	UniSTS
Cytogenetic Map	2	q44	UniSTS
Cytogenetic Map	11	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	12	74	35	41	11	8
Low	2	4	14	5	13	5	1	2	6	7	7	9	1
Below cutoff		5	9	2	4	2	4	4	2	3		1	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M95780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000105080 ⟹ ENSRNOP00000087679

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	77,292,043 - 77,292,513 (+)	Ensembl

RefSeq Acc Id:

NM_024377 ⟹ NP_077353

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	235,394,680 - 235,403,177 (+)	NCBI
Rnor_6.0	2	252,359,976 - 252,368,473 (+)	NCBI
Rnor_5.0	2	270,886,941 - 270,895,438 (+)	NCBI
RGSC_v3.4	2	244,702,876 - 244,711,373 (+)	RGD
Celera	2	227,374,391 - 227,382,888 (+)	RGD

Sequence:

show sequence

AGTTGGCCCGGCTGTCCCGAGCGCCATGTCGGGTTCTTCTAGCGTCGCCGCCATGAAGAAGGTG
GTTCAGCAACTCCGGCTGGAGGCCGGGCTCAACCGCGTGAAGGTTTCCCAGGCAGCTGCAGACT
TGAAACAGTTCTGTCTGCAGAATGCTCAACATGACCCTCTGCTGACTGGAGTGTCTTCAAGTAC
AAATCCCTTCAGACCCCAGAAAGTCTGCTCCTTTTTGTAGTCATATATCTCGAGGTTTCTCAAA
CTACTTTTCATGAACCAGTGAATATTCACGAGAACTAAGTTCGAAGTCACTAAGTTTGAAGTCT
GTACAGAAGCTTCTCTTTAACACGTGCCATACACATAATCTTCTACTCGTCAGTCCTTAACATC
TACCTCTCTGGATTTTCATGGATCTCTGTTTCACAAGGTTTAACTGTTTTATATACACTGGCTG
TAGCATACAATAAAGCAGCATACAAACTTTTGGCCTTGTTATTGATATGAAATGTGCTGTATAC
TAATTTTTTCAACATCAGGACTCACTGCCTTATTGGCAAGGCTTCTAGGAATTTACAGAACAAC
TGCAAATCTTTGTTCAAAGGCCGGAAGACTTAAGAGTTTCTAATCCTTCAGTCAGTTATGGGAA
TTATCTTAAATATCCCAAATATAGGTAGGGAGATGGCTCGGTGGCTAAGAGCACTTGCTCTGCA
GTTAGTTATGCTGAGTTCAGATCCTGCCACCCATGTAAAAAGCTGGGCGTGGCTGTACATGCCC
GTGGCCACAGCTTCGGGGAGATGGTTTGTTGGCTGCCAGCGAGGGTAAGGTTGTAATTAGCTCC
GTGAGAACGAGGCAGAAAGGGATACAGGTGCCTGACACTGCCATGTGGGCTCACACAGGCAACA
AACAACTCTAGTGGCGTCAGCAGTTAGTGCTACCAAGAAGGTGGCTGCTTCCATCTGGAAAAAG
AGTTAAAGATTCACAGAATCAAGACCTTGAGGACTTACGACAATGCCTCAAGTAGGCAAGTGGA
GGTAATTAGGTAGAAAGGAACAAGAAAACAGGTTAACCTCTGTGACCTGTAACTTTGCTCCAAG
TCCCAATAACCTGTCCTTTAGAACTGGTATATTAAATCAGGGTCATACACTATCTACCAACAAG
CCTTTTTTCTAGCCTACAAGTTCTTTGGGAATGAAAATTATAAAGTTTGAATCGTCATTCCTAA
GAAATTATTACAACTAATCCAAAATGACAACAGCTTTTATGACTTTCATACATAATTTTTCAGA
CAAAAATAAAATTATATTTATTTATATTTACTATATGCAGTGGAAACTCATAGCACTTGGTCAT
TTCTTCAAACACAGGATTTATAAAATAAAATCCCATTTTGAAAAGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077353	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41188	(Get FASTA)	NCBI Sequence Viewer
	AAH58469	(Get FASTA)	NCBI Sequence Viewer
	AAZ23832	(Get FASTA)	NCBI Sequence Viewer
	AAZ23833	(Get FASTA)	NCBI Sequence Viewer
	EDL82425	(Get FASTA)	NCBI Sequence Viewer
	P63219	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_077353 ⟸ NM_024377
- UniProtKB:	P63219 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKV CSFL hide sequence

RefSeq Acc Id:

ENSRNOP00000087679 ⟸ ENSRNOT00000105080

Protein Domains

G protein gamma

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P63219-F1-model_v2	AlphaFold	P63219	1-68	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691815

Promoter ID:

EPDNEW_R2340

Type:

initiation region

Name:

LOC108349548_1

Description:

guanine nucleotide-binding protein G/G/G subunit gamma-5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	252,359,976 - 252,360,036	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620807	AgrOrtholog
BioCyc Gene	G2FUF-50900	BioCyc
Ensembl Genes	ENSRNOG00000015936	Ensembl
	ENSRNOG00000063636	Ensembl, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000087679.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000105080.1	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.260.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6918279	IMAGE-MGC_LOAD
InterPro	G-protein_gamma-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GGL_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Gprotein-gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:108349548	UniProtKB/Swiss-Prot
	rno:79218	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72806	IMAGE-MGC_LOAD
NCBI Gene	79218	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(O) SUBUNIT GAMMA-5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13809	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	G-gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gng5	PhenoGen
PRINTS	GPROTEING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_GAMMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	G_gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GGL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48670	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	GBG5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q45QK8_RAT	UniProtKB/TrEMBL
UniProt Secondary	P30670	UniProtKB/Swiss-Prot
	Q61015	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gng5	G protein subunit gamma 5	Gng5	guanine nucleotide binding protein (G protein), gamma 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-31	Gng5	guanine nucleotide binding protein (G protein), gamma 5	Gng5	guanine nucleotide binding protein (G protein), gamma 5 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Gng5	guanine nucleotide binding protein (G protein), gamma 5 subunit		G protein gamma-5 subunit	Name updated	1299863	APPROVED
2002-08-07	Gng5	G protein gamma-5 subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)