P2rx4 (purinergic receptor P2X 4)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: P2rx4 (purinergic receptor P2X 4) Rattus norvegicus

Analyze

Symbol:

P2rx4

Name:

purinergic receptor P2X 4

RGD ID:

62073

Description:

Enables several functions, including ATP binding activity; ligand-gated cation channel activity; and transition metal ion binding activity. Involved in several processes, including cellular response to zinc ion; neuronal action potential; and positive regulation of microglial cell migration. Located in several cellular components, including dendritic spine; neuronal cell body; and postsynaptic density. Biomarker of congestive heart failure. Orthologous to human P2RX4 (purinergic receptor P2X 4); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; ATP.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP receptor; P2X purinoceptor 4; P2X4; purinergic receptor P2X ligand-gated ion channel 4; purinergic receptor P2X, ligand-gated ion channel 4

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	33,844,609 - 33,862,265 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,844,396 - 33,862,253 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	35,022,338 - 35,040,001 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,633,773 - 35,651,436 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	12	34,686,065 - 34,703,728 (-)	NCBI	Rnor_WKY
Rnor_6.0	12	39,308,022 - 39,325,673 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	39,308,025 - 39,325,673 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	41,196,777 - 41,214,428 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,943,900 - 34,961,551 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,807,290 - 34,824,939 (-)	NCBI
Celera	12	35,521,444 - 35,539,095 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congestive heart failure (IEP)

COVID-19 (ISO)

epilepsy (ISO)

Hyperalgesia (IMP)

Peripheral Nerve Injuries (IEP)

temporal lobe epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

ATP (EXP,ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

Benzo[k]fluoranthene (ISO)

benzoates (ISO)

bisphenol A (EXP,ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

cisplatin (ISO)

cobalt atom (EXP)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

cyproconazole (ISO)

diclofenac (EXP)

dieldrin (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

formaldehyde (ISO)

gentamycin (EXP)

ginsenoside C-K (ISO)

ginsenoside Rb1 (ISO)

ginsenoside Rd (ISO)

heptachlor (EXP)

hydroquinone (ISO)

ivermectin (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

luteolin (EXP)

mercury atom (EXP)

mercury(0) (EXP)

methamphetamine (EXP)

methapyrilene (EXP)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

nitrogen dioxide (ISO)

paclitaxel (EXP)

paracetamol (EXP,ISO)

permethrin (EXP)

phenobarbital (ISO)

propiconazole (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

temozolomide (ISO)

testosterone (ISO)

toluene 2,4-diisocyanate (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

XL147 (ISO)

zinc atom (EXP)

zinc(0) (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic signaling pathway (ISO)

behavioral response to pain (IMP)

calcium ion transmembrane transport (IDA,ISO)

calcium ion transport (ISO)

calcium-mediated signaling (IEA)

cation transmembrane transport (IEA,ISO)

cellular response to ATP (IDA,IMP,ISO,ISS)

cellular response to zinc ion (IDA)

clathrin-dependent endocytosis (IMP)

excitatory postsynaptic potential (IEA,ISO)

inorganic cation transmembrane transport (IDA)

ion transmembrane transport (ISO)

membrane depolarization (ISO)

negative regulation of cardiac muscle hypertrophy (ISO)

neuronal action potential (IDA)

nitric oxide biosynthetic process (ISO)

positive regulation of blood vessel endothelial cell migration (ISO)

positive regulation of calcium ion transport into cytosol (ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of endothelial cell chemotaxis (ISO)

positive regulation of microglial cell migration (IMP)

positive regulation of protein kinase B signaling (IMP)

purinergic nucleotide receptor signaling pathway (IEA,ISO)

regulation of blood pressure (ISO)

regulation of cardiac muscle contraction (ISO)

regulation of chemotaxis (IMP)

regulation of response to drug (IMP)

regulation of ruffle assembly (IMP)

regulation of sodium ion transport (IDA)

relaxation of cardiac muscle (ISO)

response to ATP (IEA,ISO)

response to axon injury (IMP)

response to fluid shear stress (ISO)

response to ischemia (IMP)

sensory perception of pain (IMP)

sensory perception of touch (IMP)

signal transduction (ISO)

vasodilation (ISO)

Cellular Component

apical part of cell (ISO)

axon (IDA)

cell body (IDA)

cell junction (ISO)

dendrite (IDA)

dendritic spine (IDA)

membrane (IC,IEA,ISO)

neuronal cell body (IDA)

nuclear inner membrane (IBA)

perinuclear region of cytoplasm (ISO)

plasma membrane (IDA,IMP,ISO,ISS)

postsynapse (IEA)

postsynaptic density (IDA)

synapse (IDA)

terminal bouton (IDA)

Molecular Function

ATP binding (IC,IDA,IEA)

cadherin binding (ISO)

copper ion binding (IDA)

extracellularly ATP-gated cation channel activity (IBA,IDA,IEA,ISO)

identical protein binding (IPI,ISO)

ligand-gated calcium channel activity (IMP,ISO)

protein binding (IPI,ISO)

purinergic nucleotide receptor activity (IDA,IEA,ISO)

signaling receptor binding (IPI)

zinc ion binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Regulation of neuronal type genes in congestive heart failure rats.	Andersson KB, etal., Acta Physiol (Oxf). 2006 Jan;186(1):17-27.
2.	Identification of P2X2/P2X4/P2X6 heterotrimeric receptors using atomic force microscopy (AFM) imaging.	Antonio LS, etal., FEBS Lett. 2014 Jun 5;588(12):2125-8. doi: 10.1016/j.febslet.2014.04.048. Epub 2014 May 8.
3.	Trimeric architecture of homomeric P2X2 and heteromeric P2X1+2 receptor subtypes.	Aschrafi A, etal., J Mol Biol. 2004 Sep 3;342(1):333-43.
4.	Electron microscopic localisation of P2X4 receptor subunit immunoreactivity to pre- and post-synaptic neuronal elements and glial processes in the dorsal vagal complex of the rat.	Ashour F and Deuchars J, Brain Res. 2004 Nov 5;1026(1):44-55.
5.	A P2X purinoceptor cDNA conferring a novel pharmacological profile.	Bo X, etal., FEBS Lett 1995 Nov 13;375(1-2):129-33.
6.	An antagonist-insensitive P2X receptor expressed in epithelia and brain.	Buell G, etal., EMBO J 1996 Jan 2;15(1):55-62.
7.	Up-regulation of P2X2, P2X4 receptor and ischemic cell death: prevention by P2 antagonists.	Cavaliere F, etal., Neuroscience. 2003;120(1):85-98.
8.	Histidine 140 plays a key role in the inhibitory modulation of the P2X4 nucleotide receptor by copper but not zinc.	Coddou C, etal., J Biol Chem. 2003 Sep 19;278(38):36777-85. Epub 2003 Jun 20.
9.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.	Evidence for functional P2X4/P2X7 heteromeric receptors.	Guo C, etal., Mol Pharmacol. 2007 Dec;72(6):1447-56. Epub 2007 Sep 4.
11.	ATP- and adenosine-mediated signaling in the central nervous system: chronic pain and microglia: involvement of the ATP receptor P2X4.	Inoue K, etal., J Pharmacol Sci. 2004 Feb;94(2):112-4.
12.	Characterization of three types of ATP-activated current in relation to P2X subunits in rat trigeminal ganglion neurons.	Luo J, etal., Brain Res. 2006 Oct 18;1115(1):9-15. Epub 2006 Aug 24.
13.	Microglial P2X4R-evoked pain hypersensitivity is sexually dimorphic in rats.	Mapplebeck JCS, etal., Pain. 2018 Sep;159(9):1752-1763. doi: 10.1097/j.pain.0000000000001265.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	Involvement of P2X4 and P2Y12 receptors in ATP-induced microglial chemotaxis.	Ohsawa K, etal., Glia. 2007 Apr 15;55(6):604-16. doi: 10.1002/glia.20489.
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Distinct Localization of P2X receptors at excitatory postsynaptic specializations.	Rubio ME and Soto F, J Neurosci. 2001 Jan 15;21(2):641-53.
21.	A novel neuronal P2x ATP receptor ion channel with widespread distribution in the brain.	Seguela P, etal., J Neurosci 1996 Jan 15;16(2):448-55.
22.	Direct observation of ATP-induced conformational changes in single P2X(4) receptors.	Shinozaki Y, etal., PLoS Biol. 2009 May;7(5):e1000103. doi: 10.1371/journal.pbio.1000103. Epub 2009 May 5.
23.	P2X4: an ATP-activated ionotropic receptor cloned from rat brain.	Soto F, etal., Proc Natl Acad Sci U S A 1996 Apr 16;93(8):3684-8.
24.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
25.	Functional properties of internalization-deficient P2X4 receptors reveal a novel mechanism of ligand-gated channel facilitation by ivermectin.	Toulme E, etal., Mol Pharmacol. 2006 Feb;69(2):576-87. Epub 2005 Nov 10.
26.	P2X4 receptors induced in spinal microglia gate tactile allodynia after nerve injury.	Tsuda M, etal., Nature. 2003 Aug 14;424(6950):778-83. doi: 10.1038/nature01786.
27.	Cloning and pharmacological characterization of a fourth P2X receptor subtype widely expressed in brain and peripheral tissues including various endocrine tissues.	Wang CZ, etal., Biochem Biophys Res Commun 1996 Mar 7;220(1):196-202.

Additional References at PubMed

PMID:9016352	PMID:10515189	PMID:10899068	PMID:10969036	PMID:11606481	PMID:12077178	PMID:12088286	PMID:12105201	PMID:12600825	PMID:12788520	PMID:15081800	PMID:15130891
PMID:15489334	PMID:15528255	PMID:15795310	PMID:15885321	PMID:15890753	PMID:15985462	PMID:16327800	PMID:16534777	PMID:16943557	PMID:16949036	PMID:16973131	PMID:17264311
PMID:17560948	PMID:17897319	PMID:17918263	PMID:17940064	PMID:17990272	PMID:18427835	PMID:18675255	PMID:18837052	PMID:18938136	PMID:19056867	PMID:19084381	PMID:19283779
PMID:19295157	PMID:19298529	PMID:19304656	PMID:19351603	PMID:19447505	PMID:19562525	PMID:19767540	PMID:19946888	PMID:20009029	PMID:20026202	PMID:20056605	PMID:20406028
PMID:20407394	PMID:20590593	PMID:21106936	PMID:21378451	PMID:21482824	PMID:21844344	PMID:21907716	PMID:22053919	PMID:22222817	PMID:22230887	PMID:22393055	PMID:22785548
PMID:23220420	PMID:23303206	PMID:23524095	PMID:23533145	PMID:23555667	PMID:23771671	PMID:24254916	PMID:24569146	PMID:24798490	PMID:24817123	PMID:24943126	PMID:24997270
PMID:25070962	PMID:25074385	PMID:25398027	PMID:25662851	PMID:25680470	PMID:26481522	PMID:26946358	PMID:27506813	PMID:27545450	PMID:28306606	PMID:28461136	PMID:29973381
PMID:29997254	PMID:30306657	PMID:30507759	PMID:30537520	PMID:32198702	PMID:32428626	PMID:32979222	PMID:33398365	PMID:33639220	PMID:33966147	PMID:34638832	PMID:35290938
PMID:35594248

Genomics

Comparative Map Data

P2rx4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	33,844,609 - 33,862,265 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,844,396 - 33,862,253 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	35,022,338 - 35,040,001 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,633,773 - 35,651,436 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	12	34,686,065 - 34,703,728 (-)	NCBI	Rnor_WKY
Rnor_6.0	12	39,308,022 - 39,325,673 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	39,308,025 - 39,325,673 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	41,196,777 - 41,214,428 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,943,900 - 34,961,551 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,807,290 - 34,824,939 (-)	NCBI
Celera	12	35,521,444 - 35,539,095 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

P2RX4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	121,210,129 - 121,234,106 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	121,210,065 - 121,234,106 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	121,647,932 - 121,671,909 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	120,132,047 - 120,156,292 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	120,110,383 - 120,134,627	NCBI
Celera	12	121,285,420 - 121,309,664 (+)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	118,657,246 - 118,681,512 (+)	NCBI		HuRef
CHM1_1	12	121,616,508 - 121,640,746 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	121,200,899 - 121,224,872 (+)	NCBI		T2T-CHM13v2.0

P2rx4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	122,845,581 - 122,867,802 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	122,845,607 - 122,867,801 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	122,707,518 - 122,729,739 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	122,707,544 - 122,729,738 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	123,157,566 - 123,179,053 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	122,968,240 - 122,989,661 (+)	NCBI		MGSCv36	mm8
Celera	5	119,785,375 - 119,806,787 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	62.53	NCBI

P2rx4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	7,031,874 - 7,039,220 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	7,031,874 - 7,039,026 (-)	NCBI	ChiLan1.0	ChiLan1.0

P2RX4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	122,178,668 - 122,202,959 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	122,178,672 - 122,202,959 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	118,807,961 - 118,832,267 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

P2RX4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	7,897,528 - 7,914,279 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	7,898,015 - 7,914,234 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	8,062,300 - 8,079,042 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	8,155,694 - 8,172,441 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	8,155,705 - 8,172,399 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	8,115,630 - 8,132,371 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	8,174,205 - 8,190,943 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	8,130,559 - 8,147,306 (-)	NCBI		UU_Cfam_GSD_1.0

P2rx4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	156,402,015 - 156,417,147 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	3,059,886 - 3,077,451 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936558	3,062,279 - 3,077,493 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

P2RX4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	31,368,303 - 31,387,905 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	31,368,542 - 31,387,960 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	33,232,162 - 33,251,989 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

P2RX4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	116,585,276 - 116,609,401 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	116,585,586 - 116,609,511 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	128,472,594 - 128,496,813 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

P2rx4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	21,783,381 - 21,796,260 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	21,783,445 - 21,796,501 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in P2rx4
218 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	246
Count of miRNA genes:	170
Interacting mature miRNAs:	197
Transcripts:	ENSRNOT00000001752
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

RH137366

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,844,643 - 33,844,833 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,308,055 - 39,308,244	NCBI	Rnor6.0
Rnor_5.0	12	41,196,810 - 41,196,999	UniSTS	Rnor5.0
RGSC_v3.4	12	34,943,933 - 34,944,122	UniSTS	RGSC3.4
Celera	12	35,521,477 - 35,521,666	UniSTS
RH 3.4 Map	12	595.6	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	13	57	41	19	41			26	29	37	11
Low		30					8	11	48	6	4		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U47031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X87763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X91200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X93565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000001752 ⟹ ENSRNOP00000001752

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,844,613 - 33,862,253 (-)	Ensembl
Rnor_6.0 Ensembl	12	39,308,025 - 39,325,673 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098463 ⟹ ENSRNOP00000084396

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,844,396 - 33,862,234 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102812 ⟹ ENSRNOP00000092796

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,844,613 - 33,862,253 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110480 ⟹ ENSRNOP00000086475

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,844,616 - 33,862,234 (-)	Ensembl

RefSeq Acc Id:

NM_031594 ⟹ NP_113782

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	33,844,611 - 33,862,265 (-)	NCBI
Rnor_6.0	12	39,308,022 - 39,325,673 (-)	NCBI
Rnor_5.0	12	41,196,777 - 41,214,428 (-)	NCBI
RGSC_v3.4	12	34,943,900 - 34,961,551 (-)	RGD
Celera	12	35,521,444 - 35,539,095 (-)	RGD

Sequence:

show sequence

CGCAGCGAGCCTGCCGGAGCTGGTGGGTGGAGCTACGACCGGGAGCCGACGGTGGCGAGGGGAC
CCACAGTGTCCAAGGCGCGGAGCGGTCGGCGGAGCCATGGCGGGCTGCTGCTCCGTGCTCGGGT
CCTTCCTGTTCGAGTACGACACGCCGCGCATCGTGCTCATCCGCAGCCGTAAAGTGGGGCTCAT
GAACCGCGCGGTGCAGCTGCTCATCCTGGCTTACGTCATCGGGTGGGTGTTCGTGTGGGAAAAG
GGCTACCAGGAAACGGACTCCGTGGTCAGCTCGGTGACAACCAAAGCCAAAGGTGTGGCTGTGA
CCAACACCTCTCAGCTTGGATTCCGGATCTGGGACGTGGCGGACTATGTGATTCCAGCTCAGGA
GGAAAACTCCCTCTTCATCATGACCAACATGATCGTCACCGTGAACCAGACACAGAGCACCTGT
CCAGAGATTCCTGATAAGACCAGCATTTGTAATTCAGACGCCGACTGCACTCCTGGCTCCGTGG
ACACCCACAGCAGTGGAGTTGCGACTGGAAGATGTGTTCCTTTCAATGAGTCTGTGAAGACCTG
TGAGGTGGCTGCATGGTGCCCGGTGGAGAACGACGTTGGCGTGCCAACGCCGGCTTTCTTAAAG
GCTGCAGAAAACTTCACCCTCTTGGTAAAGAACAACATCTGGTACCCCAAGTTTAACTTCAGCA
AGAGGAACATCCTCCCCAACATCACCACGTCCTACCTCAAATCGTGCATTTACAATGCTCAAAC
GGATCCCTTCTGCCCCATATTCCGTCTTGGCACAATCGTGGGGGACGCGGGACATAGCTTCCAG
GAGATGGCAGTTGAGGGAGGCATCATGGGTATCCAGATCAAGTGGGACTGCAACCTGGATAGAG
CCGCCTCCCTTTGCCTGCCCAGATATTCCTTCCGGCGCCTGGACACCCGGGACCTGGAACACAA
TGTGTCTCCTGGCTACAATTTCAGGTTTGCCAAGTACTACAGGGACCTGGCCGGCAAAGAGCAG
CGCACACTCACCAAGGCGTACGGCATCCGCTTTGACATCATCGTGTTTGGAAAGGCTGGGAAGT
TTGACATCATCCCTACCATGATCAACGTTGGCTCTGGCTTGGCGCTCCTCGGGGTGGCGACGGT
GCTCTGTGACGTCATAGTCCTCTACTGCATGAAGAAGAAATACTACTACCGGGACAAGAAATAT
AAGTATGTGGAAGACTACGAGCAGGGTCTTTCGGGGGAGATGAACCAGTGACGCCTAAAGTTAC
ATTTCCACCCCGCTCAGCCCGCGAAGCAGAAAGATGGGGAGAGATGGCTACTGCGTCTGTCACT
CTAGAGAAAGCTCCAGAGTTTCAGCTCAGTTCTCCACTCCACAAATACTCAGGGTTGCCAAGCA
CATCTTGTTGGAGCCCGGCTCTTGCTCTGCTGCTCAGATGGGCTTCCAGATACAAGAATCCTCC
TGCTTCTGCCTCTAGGAATGCTGGGATCAAACATGTCACTTGCAATGCCCATTTCCCATGGGGA
GTTTGGCATTTTTTACATTTTACCCTTTCCTTTTGTATACATCTAAGGCTGCCCTCAGACGCAA
GACGTTCTTCCACCCTATACACCCTTTTAATCTCACTGTGTGTGGGAGGGGGGTCGTTTGCACA
CGACGCACGGTGGATGTCTGGTGTGCTGTTGGCTGGGCCACCTGTGGCTTATACAGTGTGAGCG
TATGGAGGTAGGAAGGGTCTGAGAGCAGAGACACTGCTGTGGCTTACGGACAGGCCCAGGCTCT
GTCCACGCACTTTATTTCTAAGGAAGGAGGCTCTCTCAGGTGCTGTCAGCAGGCCTGGGACACC
ATTCCTCTTCCCTATAATCAGAGAAGTTGTCCTTGTAGCAAAGGCAGGGTTAGCTTTTCCTTTT
ATAAGGGCTGTGTTGAAATGACCTAGGACCAAACATTAAAAGAAATAATTTTTTAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039089300 ⟹ XP_038945228

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	33,844,609 - 33,853,812 (-)	NCBI

RefSeq Acc Id:

XM_039089302 ⟹ XP_038945230

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	33,844,609 - 33,853,812 (-)	NCBI

RefSeq Acc Id:

XM_039089303 ⟹ XP_038945231

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	33,844,609 - 33,851,353 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_113782	(Get FASTA)	NCBI Sequence Viewer
	XP_038945228	(Get FASTA)	NCBI Sequence Viewer
	XP_038945230	(Get FASTA)	NCBI Sequence Viewer
	XP_038945231	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA99777	(Get FASTA)	NCBI Sequence Viewer
	AAC52380	(Get FASTA)	NCBI Sequence Viewer
	AAH78792	(Get FASTA)	NCBI Sequence Viewer
	CAA61037	(Get FASTA)	NCBI Sequence Viewer
	CAA62607	(Get FASTA)	NCBI Sequence Viewer
	CAA63778	(Get FASTA)	NCBI Sequence Viewer
	EDM13668	(Get FASTA)	NCBI Sequence Viewer
	EDM13669	(Get FASTA)	NCBI Sequence Viewer
	EDM13670	(Get FASTA)	NCBI Sequence Viewer
	EDM13671	(Get FASTA)	NCBI Sequence Viewer
	EDM13672	(Get FASTA)	NCBI Sequence Viewer
	P51577	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_113782 ⟸ NM_031594

- UniProtKB:

P51577 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSV
TTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEIPDKTSICNS
DADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVENDVGVPTPAFLKAAENFTLLVKNN
IWYPKFNFSKRNILPNITTSYLKSCIYNAQTDPFCPIFRLGTIVGDAGHSFQEMAVEGGIMGIQ
IKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGKEQRTLTKAYGIRFD
IIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCMKKKYYYRDKKYKYVEDYEQGLSG
EMNQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000001752 ⟸ ENSRNOT00000001752

RefSeq Acc Id:	XP_038945230 ⟸ XM_039089302
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038945228 ⟸ XM_039089300
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038945231 ⟸ XM_039089303
- Peptide Label:	isoform X3

RefSeq Acc Id:

ENSRNOP00000086475 ⟸ ENSRNOT00000110480

RefSeq Acc Id:

ENSRNOP00000084396 ⟸ ENSRNOT00000098463

RefSeq Acc Id:

ENSRNOP00000092796 ⟸ ENSRNOT00000102812

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51577-F1-model_v2	AlphaFold	P51577	1-388	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698641

Promoter ID:

EPDNEW_R9164

Type:

initiation region

Name:

P2rx4_1

Description:

purinergic receptor P2X 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	39,325,605 - 39,325,665	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:62073	AgrOrtholog
BioCyc Gene	G2FUF-19267	BioCyc
Ensembl Genes	ENSRNOG00000001300	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000001752	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000084396.1	UniProtKB/TrEMBL
	ENSRNOP00000086475.1	UniProtKB/TrEMBL
	ENSRNOP00000092796.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001752	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000098463.1	UniProtKB/TrEMBL
	ENSRNOT00000102812.1	UniProtKB/TrEMBL
	ENSRNOT00000110480.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.490.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7123247	IMAGE-MGC_LOAD
InterPro	P2X4_purnocptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P2X_extracellular_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P2X_purnocptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29659	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93356	IMAGE-MGC_LOAD
NCBI Gene	29659	ENTREZGENE
PhenoGen	P2rx4	PhenoGen
PIRSF	P2X_purinoceptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	P2X4RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P2XRECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	P2X_RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGRFAMs	P2X	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZYY2_RAT	UniProtKB/TrEMBL
	A0A8I6A3Q3_RAT	UniProtKB/TrEMBL
	A0A8I6GKC6_RAT	UniProtKB/TrEMBL
	P2RX4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	P2rx4	purinergic receptor P2X 4	P2rx4	purinergic receptor P2X, ligand-gated ion channel 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	P2rx4	purinergic receptor P2X, ligand-gated ion channel, 4			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in pancreatic islet cells	729194
gene_regulation	channel is highly permeable to Ca2+ and is modulated by extracellular Zn2+	729054

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)