Advanced Search (OLGA)

Gene: Lrpap1 (LDL receptor related protein associated protein 1) Rattus norvegicus

Analyze

Symbol:

Lrpap1

Name:

LDL receptor related protein associated protein 1

RGD ID:

620700

Description:

Enables lipase binding activity. Predicted to be involved in several processes, including amyloid-beta clearance by transcytosis; negative regulation of amyloid-beta clearance; and negative regulation of very-low-density lipoprotein particle clearance. Located in rough endoplasmic reticulum lumen and vesicle. Used to study membranous glomerulonephritis. Biomarker of membranous glomerulonephritis. Human ortholog(s) of this gene implicated in Alzheimer's disease; dementia; myocardial infarction; and myopia. Orthologous to human LRPAP1 (LDL receptor related protein associated protein 1); PARTICIPATES IN Hedgehog signaling pathway; Reelin signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-2-macroglobulin receptor-associated protein; alpha-2-MRAP; gp330-binding 45 kDa protein; low density lipoprotein receptor-related protein associated protein 1; low density lipoprotein receptor-related protein-associated protein 1; RAP

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	79,876,002 - 79,888,011 (+)	NCBI		GRCr8
mRatBN7.2	14	75,651,371 - 75,663,380 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	75,651,376 - 75,665,414 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	80,104,743 - 80,116,744 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	81,345,601 - 81,357,602 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	77,790,590 - 77,802,591 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	80,911,281 - 80,923,290 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	80,911,270 - 80,924,831 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	81,599,969 - 81,611,978 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	81,292,661 - 81,304,670 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	81,295,093 - 81,308,456 (+)	NCBI
Celera	14	74,577,874 - 74,589,883 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

dementia (ISO)

Ellis-Van Creveld syndrome (ISO)

membranous glomerulonephritis (IDA,IEP)

Metabolic Syndrome (ISO)

myocardial infarction (ISO)

Myopia 23, Autosomal Recessive (ISO)

Osteoarthritis, Experimental (IEP)

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

asbestos (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dichromium trioxide (ISO)

diethylstilbestrol (ISO)

diuron (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

Evodiamine (ISO)

fenvalerate (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

hyaluronic acid (EXP)

hydrogen peroxide (EXP)

indometacin (ISO)

ivermectin (ISO)

ketamine (EXP)

lead diacetate (ISO)

lead(0) (ISO)

leflunomide (EXP)

methyl methanesulfonate (ISO)

monosodium L-glutamate (ISO)

nitrates (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

T-2 toxin (EXP,ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

triphenyl phosphate (ISO)

troglitazone (EXP)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amyloid-beta clearance by transcytosis (IEA,ISO)

biological_process (ND)

negative regulation of amyloid-beta clearance (IEA,ISO)

negative regulation of receptor internalization (IBA,IEA,ISO)

negative regulation of very-low-density lipoprotein particle clearance (IBA,IEA,ISO)

regulation of receptor-mediated endocytosis (IEA,ISO,ISS)

signal transduction (IEA,ISO)

Cellular Component

cell surface (IEA)

cis-Golgi network (IBA,IEA,ISO,ISS)

endomembrane system (IBA)

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum-Golgi intermediate compartment (IBA,IEA,ISO,ISS)

endosome (IBA,IEA,ISO,ISS)

endosome lumen (IEA)

Golgi apparatus (IEA,ISO,ISS)

Golgi lumen (IEA)

plasma membrane (IBA,IEA,ISO)

rough endoplasmic reticulum lumen (IBA,IDA,IEA,ISO)

vesicle (IDA)

Molecular Function

heparin binding (IEA)

lipase binding (IBA,IPI)

low-density lipoprotein particle receptor binding (IBA,IEA,ISO,ISS)

protein binding (IPI,ISO)

receptor antagonist activity (IBA,IEA,ISO)

receptor ligand activity (IEA,ISO)

very-low-density lipoprotein particle receptor binding (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Hedgehog signaling pathway (ISO)

Reelin signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Location of gp330/alpha 2-m receptor-associated protein (alpha 2-MRAP) and its binding sites in kidney: distribution of endogenous alpha 2-MRAP is modified by tissue processing.	Abbate M, etal., Eur J Cell Biol. 1993 Jun;61(1):139-49.
2.	Expression of gp330 and gp330/alpha 2-macroglobulin receptor-associated protein in renal tubular differentiation.	Abbate M, etal., J Am Soc Nephrol. 1994 Jun;4(12):2003-15.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Variation in the lipoprotein receptor-related protein, alpha2-macroglobulin and lipoprotein receptor-associated protein genes in relation to plasma lipid levels and risk of early myocardial infarction.	Gonzalez P, etal., Coron Artery Dis. 2002 Aug;13(5):251-4.
5.	Direct binding of Reelin to VLDL receptor and ApoE receptor 2 induces tyrosine phosphorylation of disabled-1 and modulates tau phosphorylation.	Hiesberger T, etal., Neuron. 1999 Oct;24(2):481-9.
6.	Role of receptor-associated 39/45 kD protein in active Heymann nephritis.	Huang J and Makker SP, Kidney Int. 1995 Feb;47(2):432-41.
7.	Analysis of a 45-kDa protein that binds to the Heymann nephritis autoantigen GP330.	Kanalas JJ and Makker SP, J Biol Chem 1993 Apr 15;268(11):8188-92.
8.	Transcription and translation of gp600 and receptor-associated protein (RAP) in active Heymann nephritis.	Makker SP, etal., Am J Pathol. 1995 Jun;146(6):1481-7.
9.	Evidence for substantial effect modification by gender in a large-scale genetic association study of the metabolic syndrome among coronary heart disease patients.	McCarthy JJ, etal., Hum Genet. 2003 Dec;114(1):87-98. Epub 2003 Oct 14.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
13.	Interaction of lipoprotein lipase and receptor-associated protein.	Page S, etal., J Biol Chem. 2006 May 19;281(20):13931-8. Epub 2006 Mar 3.
14.	LRP-associated protein gene (LRPAP1) and susceptibility to degenerative dementia.	Pandey P, etal., Genes Brain Behav. 2008 Nov;7(8):943-50. doi: 10.1111/j.1601-183X.2008.00436.x. Epub 2008 Aug 21.
15.	Molecular cloning of a cDNA encoding a major pathogenic domain of the Heymann nephritis antigen gp330.	Pietromonaco S, etal., Proc Natl Acad Sci U S A 1990 Mar;87(5):1811-5.
16.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Comprehensive gene review and curation	RGD comprehensive gene curation
21.	Variation in the LRP-associated protein gene (LRPAP1) is associated with late-onset Alzheimer disease.	Sanchez L, etal., Am J Med Genet 2001 Jan 8;105(1):76-8.
22.	Opposite effect of JAK2 on insulin-dependent activation of mitogen-activated protein kinases and Akt in muscle cells: possible target to ameliorate insulin resistance.	Thirone AC, etal., Diabetes. 2006 Apr;55(4):942-51.
23.	Functional expression of low density lipoprotein receptor-related protein is controlled by receptor-associated protein in vivo.	Willnow TE, etal., Proc Natl Acad Sci U S A 1995 May 9;92(10):4537-41.
24.	[Expression of lipoprotein related genes in subchondral bone of early experimental osteoarthritis].	Zhang RK, etal., Zhongguo Gu Shang. 2014 Jan;27(1):54-7.

Additional References at PubMed

PMID:1718973	PMID:7774585	PMID:8083232	PMID:11294867	PMID:12477932	PMID:15082773	PMID:15489334	PMID:16227578	PMID:16263759	PMID:19098903	PMID:23386614	PMID:26005850
PMID:26514267

Genomics

Comparative Map Data

Lrpap1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	79,876,002 - 79,888,011 (+)	NCBI		GRCr8
mRatBN7.2	14	75,651,371 - 75,663,380 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	75,651,376 - 75,665,414 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	80,104,743 - 80,116,744 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	81,345,601 - 81,357,602 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	77,790,590 - 77,802,591 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	80,911,281 - 80,923,290 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	80,911,270 - 80,924,831 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	81,599,969 - 81,611,978 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	81,292,661 - 81,304,670 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	81,295,093 - 81,308,456 (+)	NCBI
Celera	14	74,577,874 - 74,589,883 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

LRPAP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	3,503,612 - 3,532,422 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	3,503,612 - 3,532,446 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	3,505,339 - 3,534,149 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	3,484,093 - 3,503,941 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	3,551,263 - 3,571,113	NCBI
Celera	4	3,424,737 - 3,444,504 (-)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	3,444,900 - 3,473,683 (-)	NCBI		HuRef
CHM1_1	4	3,503,272 - 3,531,989 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	3,503,365 - 3,532,077 (-)	NCBI		T2T-CHM13v2.0

Lrpap1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	35,248,834 - 35,263,043 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	35,248,845 - 35,263,110 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	35,091,490 - 35,105,699 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	35,091,501 - 35,105,766 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	35,434,155 - 35,448,346 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	35,408,367 - 35,422,558 (-)	NCBI		MGSCv36	mm8
Celera	5	32,566,121 - 32,580,312 (-)	NCBI		Celera
Cytogenetic Map	5	B2	NCBI
cM Map	5	18.01	NCBI

Lrpap1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	2,195,228 - 2,208,688 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955514	2,195,228 - 2,208,258 (-)	NCBI	ChiLan1.0	ChiLan1.0

LRPAP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	3,858,625 - 3,878,994 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	3,792,202 - 3,812,563 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	3,663,649 - 3,683,450 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	3,646,179 - 3,666,098 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	3,646,179 - 3,666,098 (-)	Ensembl	panpan1.1		panPan2

LRPAP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	60,840,804 - 60,852,821 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	60,840,882 - 60,901,258 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	63,491,109 - 63,503,659 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	61,316,241 - 61,328,837 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	61,316,257 - 61,433,695 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	60,810,231 - 60,822,660 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	61,016,034 - 61,028,737 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	61,371,717 - 61,384,645 (+)	NCBI		UU_Cfam_GSD_1.0

Lrpap1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	66,532,896 - 66,549,059 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	20,234,533 - 20,250,751 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	20,234,582 - 20,250,756 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LRPAP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	2,125,405 - 2,145,647 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	2,129,492 - 2,145,632 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	1,826,228 - 1,842,355 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LRPAP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	45,206,455 - 45,225,766 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	45,206,618 - 45,225,767 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	1,560,408 - 1,579,681 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lrpap1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	24,436,208 - 24,449,147 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624755	24,436,128 - 24,447,923 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Lrpap1
67 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	486
Count of miRNA genes:	252
Interacting mature miRNAs:	307
Transcripts:	ENSRNOT00000012665
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	68757796	83368335	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	73415323	92554092	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	95876975	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	73415323	92554092	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat

Markers in Region

RH132960

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	75,664,418 - 75,664,638 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	80,924,329 - 80,924,548	NCBI	Rnor6.0
Rnor_5.0	14	81,613,017 - 81,613,236	UniSTS	Rnor5.0
RGSC_v3.4	14	81,305,709 - 81,305,928	UniSTS	RGSC3.4
Celera	14	74,590,922 - 74,591,141	UniSTS
Cytogenetic Map	14	q21	UniSTS

BI281742

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	75,663,074 - 75,663,278 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	80,922,985 - 80,923,188	NCBI	Rnor6.0
Rnor_5.0	14	81,611,673 - 81,611,876	UniSTS	Rnor5.0
RGSC_v3.4	14	81,304,365 - 81,304,568	UniSTS	RGSC3.4
Celera	14	74,589,578 - 74,589,781	UniSTS
Cytogenetic Map	14	q21	UniSTS

D12S1329

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	75,660,750 - 75,661,576 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	207,115,949 - 207,117,499 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	226,520,548 - 226,522,097	NCBI	Rnor6.0
Rnor_6.0	14	80,920,661 - 80,921,486	NCBI	Rnor6.0
Rnor_5.0	14	81,609,349 - 81,610,174	UniSTS	Rnor5.0
Rnor_5.0	1	233,466,755 - 233,468,304	UniSTS	Rnor5.0
RGSC_v3.4	1	212,956,967 - 212,958,516	UniSTS	RGSC3.4
RGSC_v3.4	14	81,302,041 - 81,302,866	UniSTS	RGSC3.4
Celera	14	74,587,254 - 74,588,079	UniSTS
Celera	1	204,609,452 - 204,611,001	UniSTS
Cytogenetic Map	1	q43	UniSTS
Cytogenetic Map	14	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001169113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC082020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM055449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M31051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z11994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012665 ⟹ ENSRNOP00000012665

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	75,651,376 - 75,665,414 (+)	Ensembl
Rnor_6.0 Ensembl	14	80,911,270 - 80,924,831 (+)	Ensembl

RefSeq Acc Id:

NM_001169113 ⟹ NP_001162584

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	79,876,002 - 79,888,011 (+)	NCBI
mRatBN7.2	14	75,651,371 - 75,663,380 (+)	NCBI
Rnor_6.0	14	80,911,281 - 80,923,290 (+)	NCBI
Rnor_5.0	14	81,599,969 - 81,611,978 (+)	NCBI
RGSC_v3.4	14	81,292,661 - 81,304,670 (+)	RGD
Celera	14	74,577,874 - 74,589,883 (+)	RGD

Sequence:

show sequence

AGGCCTGTCAGTCTGCTAGCTCTGCAGAGGAAGATGGCGCCTCTTAGAGACAGGGTCTCTACGC
TGCCCCGGCTCCAACTGCTAGTGCTGTTGTTGCTGCCGCTGCTGCTTGTGCCCCAGCCCATCGC
AGGTCATGGCGGCAAGTACTCGCGGGAGAAGAATGAGCCCGAGATGGCCGCCAAGCGTGAGTCC
GGGGAGGAGTTCCGCATGGAGAAGCTGAACCAGCTATGGGAGAAGGCCAAGCGGCTGCATCTGT
CTCCTGTGAGGCTGGCCGAGCTGCATTCTGACCTGAAGATACAAGAGAGGGATGAACTCAACTG
GAAGAAGCTGAAGGTGGAAGGCCTAGACGGGGATGGGGAGAAAGAAGCAAAACTGGTCCACAAT
CTCAATGTCATCCTGGCCAGGTACGGACTGGATGGGAGGAAGGACACCCAGACAGTGCACAGCA
ACGCCCTCAATGAAGACACCCAGGATGAGCTGGGGGACCCCAGGTTGGAAAAGCTGTGGCACAA
GGCAAAGACATCAGGGAAATTCTCCAGTGAAGAACTGGACAAGCTGTGGCGAGAGTTTCTGCAC
TACAAAGAGAAGATCCACGAGTACAATGTACTGCTAGATACACTGAGCAGAGCTGAAGAAGGTT
ATGAGAACCTTCTCAGCCCCTCTGACATGACCCACATCAAGAGTGACACCCTGGCCAGCAAGCA
CAGTGAACTGAAGGACAGACTGCGTAGTATCAACCAGGGCCTAGACCGCCTGAGGAAGGTCAGC
CACCAGGGCTACGGCCCCGCCACTGAGTTTGAAGAGCCCCGAGTGATAGATCTGTGGGACCTGG
CTCAGTCTGCCAACTTCACCGAGAAGGAACTGGAGTCGTTCAGGGAGGAGCTTAAGCACTTCGA
GGCCAAAATCGAAAAGCACAACCACTACCAGAAGCAGCTGGAGATTTCCCACCAGAAGCTGAAG
CACGTGGAGAGCATCGGTGACCCCGAGCACATCAGCCGCAACAAGGAGAAGTACGTCCTGCTGG
AGGAGAAGACAAAGGAGCTGGGCTACAAGGTGAAGAAGCATCTGCAGGACCTGTCCAGCAGGGT
CTCAAGGGCTCGGCACAATGAGCTCTGAGACCAGAAGCCACTGGCAGTAGCCTAGAGAGGCTCT
TGAAGACACTGGGAACTGTCAACTTGTCATACTGGTGTGGCTGTCCACAGTGGCAAGGAGAAAT
ACCGATCTGATCCTGCTGCGGCTGGCAAGGACTAATTTTCTTTCAAGCAAGTGTAGCTGTCACC
GCCCTGGTTGAGGGCTTTGGGTACATCTACCAATGAGATATGACCGGTCTCCATGCTGCAGCAA
AAGTTTACATTGAAATTATATAAATCTGTCACTGGAAATGTTATGTACAGAGTCCTTAAATACA
TGGCAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001162584	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41269	(Get FASTA)	NCBI Sequence Viewer
	AAH82020	(Get FASTA)	NCBI Sequence Viewer
	AAH98947	(Get FASTA)	NCBI Sequence Viewer
	CAA78040	(Get FASTA)	NCBI Sequence Viewer
	EDM00070	(Get FASTA)	NCBI Sequence Viewer
	EDM00071	(Get FASTA)	NCBI Sequence Viewer
	EDM00072	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012665
	ENSRNOP00000012665.4
GenBank Protein	Q99068	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001162584 ⟸ NM_001169113
- Peptide Label:	precursor
- UniProtKB:	Q642A1 (UniProtKB/Swiss-Prot), Q4FZX8 (UniProtKB/Swiss-Prot), Q64723 (UniProtKB/Swiss-Prot), Q99068 (UniProtKB/Swiss-Prot), A6IK06 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRMEKLNQ LWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNVILARYGLD GRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFLHYKEKIHEYNVL LDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDRLRKVSHQGYGPATEFE EPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHI SRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL hide sequence

Ensembl Acc Id:

ENSRNOP00000012665 ⟸ ENSRNOT00000012665

Protein Domains

Alpha-2-macroglobulin RAP C-terminal Alpha-2-macroglobulin receptor-associated protein

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99068-F1-model_v2	AlphaFold	Q99068	1-360	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699391

Promoter ID:

EPDNEW_R9916

Type:

multiple initiation site

Name:

Lrpap1_1

Description:

LDL receptor related protein associated protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	80,911,306 - 80,911,366	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620700	AgrOrtholog
BioCyc Gene	G2FUF-15314	BioCyc
Ensembl Genes	ENSRNOG00000009313	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012665	ENTREZGENE
	ENSRNOT00000012665.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.81.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7129428	IMAGE-MGC_LOAD
	IMAGE:7460622	IMAGE-MGC_LOAD
InterPro	A2-macroglobuin_RAP	UniProtKB/Swiss-Prot
	Alpha_2_MRAP_C	UniProtKB/Swiss-Prot
	MG_RAP_rcpt_1	UniProtKB/Swiss-Prot
	RAP_D2	UniProtKB/Swiss-Prot
	RAP_D3	UniProtKB/Swiss-Prot
	RAP_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:116565	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114561	IMAGE-MGC_LOAD
	MGC:95147	IMAGE-MGC_LOAD
NCBI Gene	116565	ENTREZGENE
PANTHER	ALPHA-2-MACROGLOBULIN RECEPTOR-ASSOCIATED PROTEIN	UniProtKB/Swiss-Prot
	PTHR16560	UniProtKB/Swiss-Prot
Pfam	Alpha-2-MRAP_C	UniProtKB/Swiss-Prot
	Alpha-2-MRAP_N	UniProtKB/Swiss-Prot
PhenoGen	Lrpap1	PhenoGen
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009313	RatGTEx
Superfamily-SCOP	SSF47045	UniProtKB/Swiss-Prot
UniProt	A6IK06	ENTREZGENE, UniProtKB/TrEMBL
	A6IK07_RAT	UniProtKB/TrEMBL
	A6IK08_RAT	UniProtKB/TrEMBL
	AMRP_RAT	UniProtKB/Swiss-Prot
	Q4FZX8	ENTREZGENE
	Q642A1	ENTREZGENE
	Q64723	ENTREZGENE
	Q99068	ENTREZGENE
UniProt Secondary	Q4FZX8	UniProtKB/Swiss-Prot
	Q642A1	UniProtKB/Swiss-Prot
	Q64723	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-11	Lrpap1	LDL receptor related protein associated protein 1	Lrpap1	low density lipoprotein receptor-related protein associated protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Lrpap1	low density lipoprotein receptor-related protein associated protein 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Lrpap1	low density lipoprotein receptor-related protein associated protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)