Bcl10 (BCL10, immune signaling adaptor)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Bcl10 (BCL10, immune signaling adaptor) Rattus norvegicus

Analyze

Symbol:

Bcl10

Name:

BCL10, immune signaling adaptor

RGD ID:

620544

Description:

Predicted to enable several functions, including CARD domain binding activity; NF-kappaB binding activity; and enzyme binding activity. Predicted to contribute to kinase activator activity. Involved in positive regulation of apoptotic process. Part of protein-containing complex. Human ortholog(s) of this gene implicated in extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue; immunodeficiency 37; malignant mesothelioma; and non-Hodgkin lymphoma. Orthologous to human BCL10 (BCL10 immune signaling adaptor); PARTICIPATES IN nuclear factor kappa B signaling pathway; B cell receptor signaling pathway; T cell receptor signaling pathway; INTERACTS WITH (+)-pilocarpine; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-cell CLL/lymphoma 10; B-cell leukemia/lymphoma 10; B-cell lymphoma/leukemia 10; bcl-10; R-RCD1; RCD

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BCL10 (BCL10 immune signaling adaptor)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Bcl10 (B cell leukemia/lymphoma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bcl10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bcl10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bcl10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLMAP (sarcolemma associated protein)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Bcl10 (B cell leukemia/lymphoma 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BCL10 (BCL10 immune signaling adaptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bcl10 (BCL10 immune signaling adaptor)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bcl10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	234,840,880 - 234,850,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	234,840,858 - 234,850,523 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	242,633,160 - 242,642,800 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	240,523,460 - 240,533,107 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,390,779 - 235,400,419 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	251,805,392 - 251,814,957 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	251,805,392 - 251,814,957 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,330,540 - 270,340,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	244,116,880 - 244,126,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	244,103,619 - 244,113,130 (+)	NCBI
Celera	2	226,822,923 - 226,832,565 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colon carcinoma (ISO)

extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue (ISO)

follicular lymphoma (ISO)

genetic disease (ISO)

immunodeficiency 37 (ISO)

malignant mesothelioma (ISO)

marginal zone lymphoma (ISO)

Mesothelioma (ISO)

non-Hodgkin lymphoma (ISO)

Sezary's disease (ISO)

T-cell acute lymphoblastic leukemia (ISO)

testicular cancer (ISO)

Testicular Germ Cell Tumor (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1H-pyrazole (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methoxyethanol (EXP)

3-methylcholanthrene (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP)

calcitriol (ISO)

capsaicin (ISO)

carbon nanotube (ISO)

carmustine (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

curcumin (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

diquat (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

furosemide (EXP)

genistein (ISO)

gentamycin (EXP)

glyphosate (EXP)

hydrogen peroxide (ISO)

iron atom (ISO)

iron(0) (ISO)

ivermectin (ISO)

lead diacetate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

Myrtucommulone A (ISO)

N-methyl-N-nitrosourea (EXP)

N-nitrosodiethylamine (ISO)

nickel dichloride (EXP)

nitrates (EXP)

o-anisidine (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentobarbital (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phosgene (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sulforaphane (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

Tributyltin oxide (EXP,ISO)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IBA,ISO,ISS)

antifungal innate immune response (ISO,ISS)

apoptotic process (IEA)

B cell apoptotic process (ISO)

canonical NF-kappaB signal transduction (IBA,ISO)

cellular defense response (ISO)

cellular response to lipopolysaccharide (ISO,ISS)

cellular response to mechanical stimulus (ISO)

fibroblast apoptotic process (ISO)

immunoglobulin mediated immune response (ISO)

innate immune response (ISO,ISS)

lipopolysaccharide-mediated signaling pathway (ISO,ISS)

negative regulation of mature B cell apoptotic process (ISO,ISS)

neural tube closure (ISO,ISS)

positive regulation of apoptotic process (IDA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO,ISS)

positive regulation of cytokine production (ISO)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of extrinsic apoptotic signaling pathway (IBA,ISO,ISS)

positive regulation of interleukin-8 production (ISO,ISS)

positive regulation of phosphorylation (ISO,ISS)

positive regulation of protein ubiquitination (ISO,ISS)

positive regulation of T cell activation (ISO)

positive regulation of T cell receptor signaling pathway (ISO,ISS)

programmed cell death (ISO,ISS)

protein homooligomerization (ISO,ISS)

regulation of apoptotic process (IEA)

regulation of T cell receptor signaling pathway (ISO)

response to food (ISO,ISS)

response to fungus (ISO)

T cell apoptotic process (ISO)

T cell receptor signaling pathway (ISO,ISS)

thymocyte apoptotic process (ISO)

toll-like receptor signaling pathway (ISO)

Cellular Component

CBM complex (IBA,ISO,ISS)

cytoplasm (ISO,ISS)

cytoplasmic microtubule (ISO,ISS)

cytosol (IBA,ISO,ISS)

immunological synapse (ISO)

lysosome (ISO,ISS)

membrane raft (ISO)

nucleus (ISO,ISS)

perinuclear region of cytoplasm (ISO,ISS)

polkadots (ISO)

protein-containing complex (IDA,ISO,ISS)

Molecular Function

CARD domain binding (ISO)

general transcription initiation factor binding (ISO,ISS)

identical protein binding (ISO,ISS)

kinase activator activity (IBA,ISO,ISS)

NF-kappaB binding (IBA,ISO,ISS)

protease binding (ISO)

protein binding (IPI,ISO,ISS)

protein kinase B binding (IBA,ISO,ISS)

protein self-association (ISO,ISS)

protein-containing complex binding (IPI)

transcription coactivator activity (IBA,ISO,ISS)

ubiquitin protein ligase binding (ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

B cell receptor signaling pathway (IEA)

nuclear factor kappa B signaling pathway (ISO)

T cell receptor signaling pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.	Dong W, etal., J Biol Chem. 2006 Sep 8;281(36):26029-40. Epub 2006 Jul 10.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Caspase recruitment domain (CARD)-dependent cytoplasmic filaments mediate bcl10-induced NF-kappaB activation.	Guiet C and Vito P, J Cell Biol. 2000 Mar 20;148(6):1131-40.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Bcl10 is a positive regulator of antigen receptor-induced activation of NF-kappaB and neural tube closure.	Ruland J, etal., Cell 2001 Jan 12;104(1):33-42.
14.	Formation of a tumour necrosis factor receptor 1 molecular scaffolding complex and activation of apoptosis signal-regulating kinase 1 during seizure-induced neuronal death.	Shinoda S, etal., Eur J Neurosci. 2003 May;17(10):2065-76.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	Regulatory mechanisms of TRAF2-mediated signal transduction by Bcl10, a MALT lymphoma-associated protein.	Yoneda T, etal., J Biol Chem 2000 Apr 14;275(15):11114-20.

Additional References at PubMed

PMID:10187771	PMID:10400625	PMID:11021819	PMID:11053425	PMID:11238466	PMID:11278692	PMID:11466612	PMID:11821383	PMID:12154360	PMID:12761501	PMID:12867038	PMID:14614861
PMID:14695475	PMID:14724296	PMID:15082780	PMID:15125833	PMID:15207693	PMID:15489334	PMID:15878976	PMID:16127295	PMID:16280327	PMID:16395405	PMID:16495340	PMID:16862125
PMID:17052756	PMID:17095757	PMID:18223652	PMID:19593445	PMID:22267217	PMID:23264731	PMID:25365219	PMID:25416956	PMID:28628108

Genomics

Comparative Map Data

Bcl10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	234,840,880 - 234,850,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	234,840,858 - 234,850,523 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	242,633,160 - 242,642,800 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	240,523,460 - 240,533,107 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,390,779 - 235,400,419 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	251,805,392 - 251,814,957 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	251,805,392 - 251,814,957 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,330,540 - 270,340,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	244,116,880 - 244,126,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	244,103,619 - 244,113,130 (+)	NCBI
Celera	2	226,822,923 - 226,832,565 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

BCL10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	85,265,776 - 85,276,632 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	85,265,776 - 85,276,632 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	85,731,459 - 85,742,315 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	85,504,047 - 85,516,171 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	85,443,952 - 85,455,604	NCBI
Celera	1	83,975,888 - 83,987,016 (-)	NCBI		Celera
Cytogenetic Map	1	p22.3	NCBI
HuRef	1	83,842,452 - 83,853,578 (-)	NCBI		HuRef
CHM1_1	1	85,847,075 - 85,858,194 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	85,106,896 - 85,118,200 (-)	NCBI		T2T-CHM13v2.0

Bcl10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	145,630,017 - 145,640,121 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	145,628,559 - 145,640,111 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	145,924,262 - 145,934,366 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	145,922,804 - 145,934,356 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	145,587,342 - 145,597,247 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	145,861,764 - 145,871,669 (+)	NCBI		MGSCv36	mm8
Celera	3	152,377,901 - 152,387,817 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI
cM Map	3	71.03	NCBI

Bcl10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	8,709,890 - 8,722,050 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	8,710,231 - 8,720,530 (+)	NCBI	ChiLan1.0	ChiLan1.0

BCL10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	140,811,692 - 140,822,264 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	117,823,388 - 117,834,314 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	86,679,646 - 86,690,841 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

BCL10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	62,712,937 - 62,723,852 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	62,712,971 - 62,722,368 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	65,361,863 - 65,372,548 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	63,252,846 - 63,263,759 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	63,252,838 - 63,263,752 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	62,780,042 - 62,790,957 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	62,750,582 - 62,761,263 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	63,258,042 - 63,268,727 (+)	NCBI		UU_Cfam_GSD_1.0

Bcl10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	95,863,804 - 95,871,302 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936608	434,978 - 442,391 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936608	434,740 - 442,162 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BCL10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	130,645,216 - 130,657,995 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	130,645,427 - 130,653,317 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	143,237,003 - 143,244,894 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BCL10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	48,073,489 - 48,084,635 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	48,073,800 - 48,085,136 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	69,724,709 - 69,736,042 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bcl10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	12,210,360 - 12,221,759 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	12,210,333 - 12,222,533 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bcl10
46 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	516
Count of miRNA genes:	248
Interacting mature miRNAs:	312
Transcripts:	ENSRNOT00000019911
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
9587428	Epfw6	Epididymal fat weight QTL 6	7.47	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	2	223389739	249053267	Rat
7411555	Bw132	Body weight QTL 132		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	223389739	249053267	Rat
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	229059610	249053267	Rat

Markers in Region

RH130053

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	234,850,298 - 234,850,457 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	251,814,736 - 251,814,894	NCBI	Rnor6.0
Rnor_5.0	2	270,339,884 - 270,340,042	UniSTS	Rnor5.0
RGSC_v3.4	2	244,126,172 - 244,126,330	UniSTS	RGSC3.4
Celera	2	226,832,344 - 226,832,502	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	56	41	19	41	2	2	74	35	40	11	2
Low		8	1				6	9			1		6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB016069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000019911 ⟹ ENSRNOP00000019911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	234,840,858 - 234,850,517 (+)	Ensembl
Rnor_6.0 Ensembl	2	251,805,392 - 251,814,957 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096025 ⟹ ENSRNOP00000085446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	234,844,169 - 234,850,523 (+)	Ensembl

RefSeq Acc Id:

NM_031328 ⟹ NP_112618

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	234,840,880 - 234,850,520 (+)	NCBI
Rnor_6.0	2	251,805,392 - 251,814,957 (+)	NCBI
Rnor_5.0	2	270,330,540 - 270,340,105 (+)	NCBI
RGSC_v3.4	2	244,116,880 - 244,126,393 (+)	RGD
Celera	2	226,822,923 - 226,832,565 (+)	RGD

Sequence:

show sequence

GTGAACCGGCGGTTCCCCCGCTTCTGTTCCTAGTCCTCCCAAGTCACAGCCCGATTCCCGGAGG
CCCGAGCCCTTAGCCAGGGCGGGGTGGCGCGGGCCGAAAGGACGCCATCCCGGCCTCGGCCATG
GAGGCTCCCGCGCCGTCTCTCACGGAGGAGGACTTAACTGAAGTGAAGAAGGACGCTTTAGAGA
ATTTGCGAGTTTACCTGTGTGAGAAAATCATAGCTGAGAGACATTTTGATCATCTACGAGCAAA
AAAAATTCTAAGTAGAGAAGACACAGAAGAAATTTCTTGCCGAACTTCAAGTAGAAAAAGGGCT
GGGAAGTTGTTAGACTACTTACAGGAAAACCCCAAGGGACTGGACACCCTTGTGGAATCCATTC
GCAGGGAGAAAACACAGAACTTCCTGATTCAGAAGATAACGGATGAGGTGCTAAAGCTTCGGAA
TATAAAACTGGAGCACCTCAAAGGCCTGAAGTGCAGTAGCTGTGAGCCCTTCGCAGCTGGAGCC
ACCAACAACCTTTCTAGGTCCAATTCTGATGAGAGCAACTTCTCCGAGAAACAGAGACCATCCA
CGGTCATCTACCATCCAGAGGGAGAGTCGAGCACTGCTCCCTTCTTCTCTACCGAGTCATCCCT
GAATCTGCCGGTCCTGGAAGTTGGCAGGCTGGAAAACAGCAGCTTCTCTTCAGCCTCGCTTCCT
CGGCCTGGGGACCCTGGGGCCCCCCCTTTGCCCCCAGACCTGCGGTTAGAAGAGGGGGGGAGTT
GTGGAAACTCAAGTGAGATGTTTCTCCCCTTACGGTCACGGGCTCTTTCACGGCAGTGACAGGT
CACTGCGAGTTGTTCTAATAGTGGTGCAAATGGTGTGGTGGATATCATCTTTTTATAAATCACG
GGATGCGCGTCTTAAATCACAGGTGCACATAACATTCTCTGTAAATAGGATTGGAAGTGTAATG
GAGCACACTCTAGGGGCAGCTTGGTGTAAATCATGGTGGTCGTGTACTTTTCAGCATTGTCCTT
TTTTATTATTTTAAGTGTTTTGGTATTTTGAACTTTTTTATAAGACTAATTTTATCAAAATATT
TCTCAATTTGAGAAAACAACTTGTGGACCGAAAACCCTACAAGTTTTCCGCCTGGTTGTGTTTC
CTGGTGATCTGACAGTACATTTTAGCAGTAAGCTGTTCTGACTTTCAGGAAAGCCAGACATGGG
GAGAGCTGCTGACACACCCTCAGGAGAATGTCCCACTCCGTGCTTCTGAGAAGCCGTCAGGTTC
TGAGGAAACACCTGATGGCGTTGAGCCTTGTGATCTCAGTTGGCCAGAATTTGTTGTATACCTT
GCCAGTATGATTGTCTTTGCCTTTTACAGACCTTGTGTCCTCAGTCTTGGCCTGAAGAATGTTA
TCCCGGCAGGGCGCTCCTTGTAATTAATTGGTAACACTTGTAATTAGCTAAAGTCCTTGCTCTG
AGCCTTTCCTTCTCTGCCGATGAGCACTGCCATGTGGAGTTACTGTATTACAAAGTTGGCTAAC
TTTACACATTTAAAAAGTGCTGATTATTTTCTTTTAAATTATACCTATTTCTGACATCTAACTC
CTATATATTTCTATTATTTAAAAATTAAGAAATGAAAAGTTTCTATTAACAATAAAATTTTTTT
AAGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_112618	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61772	(Get FASTA)	NCBI Sequence Viewer
	BAA88822	(Get FASTA)	NCBI Sequence Viewer
	EDL82410	(Get FASTA)	NCBI Sequence Viewer
	EDL82411	(Get FASTA)	NCBI Sequence Viewer
	Q9QYN5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112618 ⟸ NM_031328

- UniProtKB:

Q9QYN5 (UniProtKB/Swiss-Prot), A6HWC4 (UniProtKB/TrEMBL), A0A8I6A3W9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKR
AGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFAAG
ATNNLSRSNSDESNFSEKQRPSTVIYHPEGESSTAPFFSTESSLNLPVLEVGRLENSSFSSASL
PRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000019911 ⟸ ENSRNOT00000019911

RefSeq Acc Id:

ENSRNOP00000085446 ⟸ ENSRNOT00000096025

Protein Domains

CARD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QYN5-F1-model_v2	AlphaFold	Q9QYN5	1-233	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620544	AgrOrtholog
BioCyc Gene	G2FUF-50916	BioCyc
Ensembl Genes	ENSRNOG00000042389	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000019911	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000085446.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019911	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000096025.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.533.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5621919	IMAGE-MGC_LOAD
InterPro	BCL10/E10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CARD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CARD_BCL10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DEATH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83477	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72408	IMAGE-MGC_LOAD
NCBI Gene	83477	ENTREZGENE
PANTHER	B-CELL LYMPHOMA/LEUKEMIA 10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR34920	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CARD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Bcl10	PhenoGen
PROSITE	CARD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47986	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A3W9	ENTREZGENE, UniProtKB/TrEMBL
	A6HWC4	ENTREZGENE, UniProtKB/TrEMBL
	A6HWC5_RAT	UniProtKB/TrEMBL
	BCL10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-11-09	Bcl10	BCL10, immune signaling adaptor	Bcl10	B-cell CLL/lymphoma 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Bcl10	B-cell CLL/lymphoma 10	Bcl10	B-cell leukemia/lymphoma 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Bcl10	B-cell leukemia/lymphoma 10	Bcl10	B-cell CLL/lymphoma 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Bcl10	B-cell CLL/lymphoma 10			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Bcl10	B-cell CLL/lymphoma 10			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	gene mutated in MALT lymphoma	631970
gene_mutations_overexpression	overexpression reduces c-Jun N-terminal kinase activation and enhanced nuclear factor kappaB activation downstream of TRAF2	631970

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)