Nphs2 (NPHS2 stomatin family member, podocin)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nphs2 (NPHS2 stomatin family member, podocin) Rattus norvegicus

Analyze

Symbol:

Nphs2

Name:

NPHS2 stomatin family member, podocin

RGD ID:

620461

Description:

Predicted to be involved in actin cytoskeleton reorganization and metanephric podocyte development. Predicted to be located in cell-cell junction; cytoplasmic side of plasma membrane; and membrane raft. Predicted to be part of protein-containing complex. Predicted to be active in plasma membrane. Predicted to colocalize with slit diaphragm. Used to study membranous glomerulonephritis and proteinuria. Biomarker of nephrotic syndrome. Human ortholog(s) of this gene implicated in nephrotic syndrome type 2. Orthologous to human NPHS2 (NPHS2 stomatin family member, podocin); INTERACTS WITH 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine; acrylamide; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC112589; nephrosis 2 homolog (human); nephrosis 2 homolog, podocin; nephrosis 2 homolog, podocin (human); nephrosis 2 idiopathic steroid-resistant (podocin); nephrosis 2, idiopathic, steroid-resistant; nephrosis 2, idiopathic, steroid-resistant (podocin); NPHS2, podocin; podocin

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	68,448,720 - 68,461,312 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	68,448,926 - 68,461,313 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	71,027,985 - 71,040,345 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	72,348,422 - 72,360,808 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	69,609,908 - 69,622,294 (+)	NCBI	Rnor_WKY
Rnor_6.0	13	73,929,136 - 73,941,522 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	73,929,136 - 73,941,522 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	78,853,114 - 78,865,500 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	71,296,482 - 71,308,868 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	71,310,669 - 71,323,056 (+)	NCBI
Celera	13	68,309,838 - 68,322,218 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

1q24 Deletion Syndrome (ISO)

Albuminuria (ISO)

autosomal recessive chronic granulomatous disease cytochrome b-positive type II (ISO)

chronic kidney disease (ISO)

familial nephrotic syndrome (ISO)

Fetal Nutrition Disorders (IEP)

focal segmental glomerulosclerosis (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

kidney disease (ISO)

membranous glomerulonephritis (IDA)

nephrosis (ISO)

nephrotic syndrome (IEP,ISO)

nephrotic syndrome type 1 (ISO)

nephrotic syndrome type 2 (ISO)

parathyroid carcinoma (ISO)

proteinuria (IDA,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

amitriptyline (ISO)

ammonium chloride (EXP)

apocynin (ISO)

aristolochic acid A (EXP)

arsenous acid (ISO)

bacitracin (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

caffeine (EXP)

CGP 52608 (ISO)

chloroprene (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Deoxycorticosterone acetate (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dibenziodolium (ISO)

doxorubicin (EXP,ISO)

ergosta-4,6,8(14),22-tetraen-3-one (ISO)

ethanol (ISO)

filipin III (ISO)

folic acid (ISO)

gentamycin (EXP)

graphite (EXP)

homocysteine (ISO)

indometacin (ISO)

lisinopril dihydrate (EXP)

losartan (ISO)

methyl beta-cyclodextrin (ISO)

mifepristone (EXP)

Nandrolone decanoate (EXP)

Pachymic acid (ISO)

paraquat (ISO)

perindopril (ISO)

pirinixic acid (ISO)

prednisone (EXP)

procyanidin B2 (EXP)

resveratrol (EXP)

silicon dioxide (ISO)

simvastatin (ISO)

sirolimus (EXP)

sodium chloride (ISO)

spironolactone (EXP)

streptozocin (EXP,ISO)

tamoxifen (ISO)

tebuconazole (ISO)

titanium dioxide (ISO)

Triptolide (EXP,ISO)

triptonide (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton reorganization (ISO)

biological_process (ND)

metanephric podocyte development (ISO)

Cellular Component

cell-cell junction (ISO)

cellular_component (ND)

cytoplasmic side of plasma membrane (ISO)

membrane raft (ISO)

obsolete intrinsic component of the cytoplasmic side of the plasma membrane (ISO)

plasma membrane (IBA,ISO)

protein-containing complex (ISO)

slit diaphragm (ISO)

Molecular Function

molecular_function (ND)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Cloning of rat homologue of podocin: expression in proteinuric states and in developing glomeruli.	Kawachi H, etal., J Am Soc Nephrol 2003 Jan;14(1):46-56.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Nephrin and podocin dissociate at the onset of proteinuria in experimental membranous nephropathy.	Nakatsue T, etal., Kidney Int. 2005 Jun;67(6):2239-53.
6.	Glomerular abundance of nephrin and podocin in experimental nephrotic syndrome: different effects of antiproteinuric therapies.	Nakhoul F, etal., Am J Physiol Renal Physiol. 2005 Oct;289(4):F880-90. Epub 2005 Jun 7.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Involvement of renal corpuscle microRNA expression on epithelial-to-mesenchymal transition in maternal low protein diet in adult programmed rats.	Sene Lde B, etal., PLoS One. 2013 Aug 19;8(8):e71310. doi: 10.1371/journal.pone.0071310. eCollection 2013.

Additional References at PubMed

PMID:11733557	PMID:11786407	PMID:12477932	PMID:15579503	PMID:15924139	PMID:16572591	PMID:17429054	PMID:17675666	PMID:19056867	PMID:21565142	PMID:23376485	PMID:23533145
PMID:24553432	PMID:25025298	PMID:25676004	PMID:26539476	PMID:27995418

Genomics

Comparative Map Data

Nphs2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	68,448,720 - 68,461,312 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	68,448,926 - 68,461,313 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	71,027,985 - 71,040,345 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	72,348,422 - 72,360,808 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	69,609,908 - 69,622,294 (+)	NCBI	Rnor_WKY
Rnor_6.0	13	73,929,136 - 73,941,522 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	73,929,136 - 73,941,522 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	78,853,114 - 78,865,500 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	71,296,482 - 71,308,868 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	71,310,669 - 71,323,056 (+)	NCBI
Celera	13	68,309,838 - 68,322,218 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

NPHS2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	179,550,539 - 179,575,948 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	179,550,539 - 179,575,952 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	179,519,674 - 179,545,083 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	177,786,299 - 177,811,691 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	176,251,332 - 176,276,725	NCBI
Celera	1	152,627,305 - 152,652,723 (-)	NCBI		Celera
Cytogenetic Map	1	q25.2	NCBI
HuRef	1	150,746,292 - 150,771,710 (-)	NCBI		HuRef
CHM1_1	1	180,943,494 - 180,968,904 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	178,905,541 - 178,930,958 (-)	NCBI		T2T-CHM13v2.0

Nphs2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	156,138,105 - 156,155,605 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	156,138,297 - 156,155,605 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	156,310,535 - 156,328,035 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	156,310,727 - 156,328,035 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	158,240,866 - 158,258,166 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	158,147,412 - 158,164,712 (+)	NCBI		MGSCv36	mm8
Celera	1	158,706,623 - 158,724,043 (+)	NCBI		Celera
Cytogenetic Map	1	G3	NCBI

Nphs2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	18,863,446 - 18,885,279 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	18,862,054 - 18,885,214 (-)	NCBI	ChiLan1.0	ChiLan1.0

NPHS2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Mhudiblu_PPA_v0	1	155,038,753 - 155,064,332 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

NPHS2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	20,347,526 - 20,375,975 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	20,354,134 - 20,374,020 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	19,880,091 - 19,899,246 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	20,091,600 - 20,110,548 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	20,091,036 - 20,110,222 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	20,000,474 - 20,019,613 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	20,106,845 - 20,127,281 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	20,242,370 - 20,261,517 (+)	NCBI		UU_Cfam_GSD_1.0

Nphs2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	91,649,128 - 91,669,416 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	9,496,127 - 9,515,534 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936481	9,496,083 - 9,516,086 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPHS2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	121,218,369 - 121,236,430 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	121,217,734 - 121,236,214 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	133,034,063 - 133,052,590 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPHS2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	49,786,126 - 49,804,917 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	51,211,593 - 51,236,827 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nphs2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	2,828,104 - 2,849,254 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	2,828,758 - 2,847,995 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nphs2
79 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	37
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000005425, ENSRNOT00000041107
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	23692969	68692969	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	23692969	68692969	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
2303028	Bp329	Blood pressure QTL 329			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	58497872	73485113	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	59492522	77046890	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium										31	3
Low	3	10	26	10	19	10	8	10	24	2	33	11	8
Below cutoff		29	11	11		11		1	48	2	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB091379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB094120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB094121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB094122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB094123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB094124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF309631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF400653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY039651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000005425 ⟹ ENSRNOP00000005425

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	68,448,929 - 68,461,313 (+)	Ensembl
Rnor_6.0 Ensembl	13	73,929,136 - 73,941,522 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094869 ⟹ ENSRNOP00000088544

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	68,448,926 - 68,461,118 (+)	Ensembl

RefSeq Acc Id:

NM_130828 ⟹ NP_570841

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	68,448,926 - 68,461,312 (+)	NCBI
Rnor_6.0	13	73,929,136 - 73,941,522 (+)	NCBI
Rnor_5.0	13	78,853,114 - 78,865,500 (+)	NCBI
RGSC_v3.4	13	71,296,482 - 71,308,868 (+)	RGD
Celera	13	68,309,838 - 68,322,218 (+)	RGD

Sequence:

show sequence

AGAAAATTGGGGCTGCGACTCTGCCAGCATCTGGCTTTGGGGGGCGTGCCCGCCGCGTAGAATG
GACAGCAGGGCGCGGAGCTCTTCCAGAAAGACCCACGGGAGAGGTAGCAGGTCCTCTTCTAGGG
ATGACAAGAAGTCAAAGGCCGGGAGGGGCAACAGAGGCCGCGCGCGCCCGGATGCTGGGGTAGA
GCGGCAGAGCGCCGGGCGGATGGGGACCCGGGAGGAGCACCGAGCTCCAGCAGCCACGGTAGTG
AATGTGGACGAGGTTCGAAGCCCGGGTGAGGAGGGTCGGAAAGTGGTGGCCCTGCTGGAGAGCG
AGCGACCAGAGGAAGGGATCAAGCCCTCTGGATTAGGGGCCTGCGAGTGGCTTCTTGTCCTCTC
CTCCCTGATCTTCATCATCGTAACGTTTCCCTTTTCCATCTGGTTCTGCATAAAGGTTGTTCAA
GAATACGAAAGAGTAATTATATTCCGACTGGGACATCTGCTTCCTGGAAGAGCCAAAGGACCTG
GCCTGTTCTTTTTTCTACCCTGCCTGGACACCTATCACAAGGTTGACCTCCGTCTCCAGACCTT
GGAAATACCTTTCCATGAGGTGGTAACCAAAGATATGTTCATAATGGAGATAGACGCTGTCTGC
TACTACCGCATGGAAAATGCCTCCCTTCTTCTAAGCAGTCTAGCTCATGTGTCCAAAGCCATCC
AGTTCCTGGTGCAAACCACCATGAAGCGCCTCTTGGCACATCGATCCCTCACTGAAATTCTCCT
GGAAAGGAAGAGCATTGCCCAAGATGTAAAGGTTGCCTTGGACTCAGTGACCTGTGTTTGGGGC
ATCAAAGTGGAGAGAACTGAAATTAAGGATGTACGGCTGCCAGCTGGGCTTCAGCACTCTCTGG
CTGTGGAAGCTGAGGCACAAAGACAGGCCAAAGTGCGGGTGATTGCTGCCGAAGGGGAAAAAGC
TGCCTCTGAGTCCCTGAGGATGGCGGCTGAGATTCTGTCAGGCACCCCAGCTGCTGTCCAGCTC
CGGTACCTGCACACTCTTCAGTCCTTGTCCACAGACAAGCCGTCCACCGTGGTTTTGCCTTTAC
CCTTTGACATGCTGAACCTTTTCTCCTCTCCCAGCAACAGAGCACAAGGAAGCATCAACTACCC
AAGTTCTCCCAAACCTGTTGAACCACTAAATCCCAAAAGGAAGGACTCTCCTATGCTATAGGGG
CGAGTGGACAAGAGTAATGGGAATACACCATATAAAGCCGTATCCCTGAGCGAGGCATTCGGTC
CCCACGCCCAGGCCCACCCTGCCCTTGTTGTTTGCCTTTTGAGTGTATCATGTCACAAGATGGA
CACACGCATGAGAACGCAGTGAAATGGCAGAGAAGACATCCAGCCACACAAGTGGGTCGTCTCA
TCATTCATTACAGGAAAGAAAGAGATTTAGAATTTTGGGTTGAGGGGCTGGAGAGATGGCTCAG
TGGTTATGAACACTGACTGTCTTCCAGAGGTCCTGAGTTCAAATTCCAGCAACCACATGGTGGC
TCACAACCATCTGTAATGGGATCCGATGCCCTTCTTCTGGTGTGTAAGACAGTGACAGTGTACT
CATATATAAGATGAATAAATAAAATCTTAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039090291 ⟹ XP_038946219

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	68,448,720 - 68,461,196 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_570841	(Get FASTA)	NCBI Sequence Viewer
	XP_038946219	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98649	(Get FASTA)	NCBI Sequence Viewer
	AAK71880	(Get FASTA)	NCBI Sequence Viewer
	AAL09446	(Get FASTA)	NCBI Sequence Viewer
	AAM90639	(Get FASTA)	NCBI Sequence Viewer
	BAC22515	(Get FASTA)	NCBI Sequence Viewer
	BAC23090	(Get FASTA)	NCBI Sequence Viewer
	BAC23091	(Get FASTA)	NCBI Sequence Viewer
	BAC23092	(Get FASTA)	NCBI Sequence Viewer
	BAC23093	(Get FASTA)	NCBI Sequence Viewer
	BAC23094	(Get FASTA)	NCBI Sequence Viewer
	EDM09488	(Get FASTA)	NCBI Sequence Viewer
	EDM09489	(Get FASTA)	NCBI Sequence Viewer
	Q8K4G9	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_570841 ⟸ NM_130828

- UniProtKB:

Q920E2 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDSRARSSSRKTHGRGSRSSSRDDKKSKAGRGNRGRARPDAGVERQSAGRMGTREEHRAPAATV
VNVDEVRSPGEEGRKVVALLESERPEEGIKPSGLGACEWLLVLSSLIFIIVTFPFSIWFCIKVV
QEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAV
CYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSIAQDVKVALDSVTCVW
GIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGEKAASESLRMAAEILSGTPAAVQ
LRYLHTLQSLSTDKPSTVVLPLPFDMLNLFSSPSNRAQGSINYPSSPKPVEPLNPKRKDSPML

hide sequence

RefSeq Acc Id:

ENSRNOP00000005425 ⟸ ENSRNOT00000005425

RefSeq Acc Id:	XP_038946219 ⟸ XM_039090291
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000088544 ⟸ ENSRNOT00000094869

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8K4G9-F1-model_v2	AlphaFold	Q8K4G9	1-383	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698914

Promoter ID:

EPDNEW_R9439

Type:

single initiation site

Name:

Nphs2_1

Description:

NPHS2, podocin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	73,929,136 - 73,929,196	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620461	AgrOrtholog
BioCyc Gene	G2FUF-17813	BioCyc
Ensembl Genes	ENSRNOG00000004030	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000005425	ENTREZGENE
	ENSRNOP00000005425.3	UniProtKB/Swiss-Prot
	ENSRNOP00000088544	ENTREZGENE
	ENSRNOP00000088544.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005425	ENTREZGENE
	ENSRNOT00000005425.7	UniProtKB/Swiss-Prot
	ENSRNOT00000094869	ENTREZGENE
	ENSRNOT00000094869.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.479.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.250.2090	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7127895	IMAGE-MGC_LOAD
InterPro	Band-7_stomatin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Band_7	UniProtKB/Swiss-Prot
	Band_7/SPFH_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Stomatin_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:170672	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112589	IMAGE-MGC_LOAD
NCBI Gene	170672	ENTREZGENE
PANTHER	PODOCIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10264	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Band_7	UniProtKB/Swiss-Prot
PhenoGen	Nphs2	PhenoGen
PRINTS	STOMATIN	UniProtKB/Swiss-Prot
SMART	PHB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF117892	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	PODO_RAT	UniProtKB/Swiss-Prot
	Q8CJD4_RAT	UniProtKB/TrEMBL
	Q8CJD5_RAT	UniProtKB/TrEMBL
	Q8CJD6_RAT	UniProtKB/TrEMBL
	Q8CJD7_RAT	UniProtKB/TrEMBL
	Q8CJD8_RAT	UniProtKB/TrEMBL
	Q8K4G9	ENTREZGENE
	Q920E2	ENTREZGENE
UniProt Secondary	Q4G090	UniProtKB/Swiss-Prot
	Q80WP2	UniProtKB/Swiss-Prot
	Q8CJE4	UniProtKB/Swiss-Prot
	Q920E2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-04	Nphs2	NPHS2 stomatin family member, podocin	Nphs2	NPHS2, podocin	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-02-01	Nphs2	NPHS2, podocin	Nphs2	nephrosis 2, idiopathic, steroid-resistant	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-07-06	Nphs2	nephrosis 2, idiopathic, steroid-resistant	Nphs2	nephrosis 2 homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-11-06	Nphs2	nephrosis 2 homolog (human)	Nphs2	nephrosis 2 homolog, podocin (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Nphs2	nephrosis 2 homolog, podocin (human)		nephrosis 2, idiopathic, steroid-resistant (podocin)	Name updated	1299863	APPROVED
2002-08-07	Nphs2	nephrosis 2, idiopathic, steroid-resistant (podocin)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	human homolog is mutated in autosomal recessive steroid resistant nephrotic syndrome	724395
gene_expression	expressed in renal glomeruli and nerve tissues	724395

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM