Chp1 (calcineurin-like EF-hand protein 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Chp1 (calcineurin-like EF-hand protein 1) Rattus norvegicus

Analyze

Symbol:

Chp1

Name:

calcineurin-like EF-hand protein 1

RGD ID:

620447

Description:

Enables calcium ion binding activity; kinase binding activity; and microtubule binding activity. Involved in several processes, including microtubule cytoskeleton organization; protein stabilization; and regulation of protein modification process. Located in several cellular components, including Golgi membrane; endoplasmic reticulum; and transport vesicle. Human ortholog(s) of this gene implicated in spastic ataxia. Orthologous to human CHP1 (calcineurin like EF-hand protein 1); PARTICIPATES IN Alzheimer's disease pathway; amyotrophic lateral sclerosis pathway; apoptotic cell death pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 2-ethoxyethanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calcineurin B homologous protein 1; calcineurin B-like protein; calcineurin homologous protein; calcium binding protein p22; calcium-binding protein CHP; calcium-binding protein p22; Chp; EF-hand Ca2+-binding protein p22; EF-hand calcium-binding domain-containing protein p22; Wrch2

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHP1 (calcineurin like EF-hand protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Chp1 (calcineurin-like EF hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chp1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHP1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHP1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chp1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHP1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHP1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chp1 (calcineurin like EF-hand protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CHP1 (calcineurin like EF-hand protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chp1 (calcineurin-like EF hand protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chp1 (calcineurin-like EF-hand protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	chpf-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	chpf-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	elm	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	106,536,009 - 106,571,255 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	106,536,004 - 106,571,251 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	110,213,376 - 110,248,697 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,808,913 - 118,844,244 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	116,469,312 - 116,504,631 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	111,354,506 - 111,389,998 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	111,354,506 - 111,389,989 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	117,902,988 - 117,938,480 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	106,066,389 - 106,101,635 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	105,962,816 - 105,998,059 (+)	NCBI
Celera	3	105,447,792 - 105,483,065 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

Spastic Ataxia 9, Autosomal Recessive (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,6-dinitrotoluene (EXP)

2-ethoxyethanol (EXP)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

aflatoxin B1 (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzbromarone (EXP)

benzene (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

clofibrate (EXP)

clofibric acid (EXP)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

diuron (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

isotretinoin (ISO)

ivermectin (ISO)

L-ethionine (EXP)

methotrexate (ISO)

methylmercury(1+) (EXP)

nickel atom (ISO)

omeprazole (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (EXP)

resveratrol (ISO)

rotenone (EXP)

sodium dichromate (ISO)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to acidic pH (ISS)

cytoplasmic microtubule organization (IDA)

membrane docking (IDA)

membrane fusion (IDA)

membrane organization (IDA)

microtubule bundle formation (IDA)

negative regulation of calcineurin-NFAT signaling cascade (ISO,ISS)

negative regulation of NF-kappaB transcription factor activity (ISO,ISS)

negative regulation of phosphatase activity (ISO,ISS)

negative regulation of protein autophosphorylation (IDA)

negative regulation of protein import into nucleus (ISO,ISS)

negative regulation of protein kinase activity (IDA)

negative regulation of protein phosphorylation (IDA)

negative regulation of protein ubiquitination (IDA)

positive regulation of phospholipid biosynthetic process (ISO)

positive regulation of protein glycosylation (IDA)

positive regulation of protein targeting to membrane (ISS)

positive regulation of protein transport (IDA)

positive regulation of sodium:proton antiporter activity (IBA,ISO,ISS)

protein complex oligomerization (IDA)

protein export from nucleus (IDA)

protein stabilization (IDA,ISS)

regulation of intracellular pH (ISO,ISS)

sodium ion transmembrane transport (IEA)

vesicle fusion (IDA)

vesicle targeting (IDA)

Cellular Component

cytoplasm (IDA)

endoplasmic reticulum (IDA)

endoplasmic reticulum-Golgi intermediate compartment (IEA)

Golgi membrane (IDA)

membrane raft (ISO)

microtubule cytoskeleton (IDA)

nucleus (IDA)

plasma membrane (IBA,IDA,ISO,ISS)

transport vesicle (IDA)

transporter complex (ISO)

Molecular Function

calcium ion binding (IDA,ISO)

calcium-dependent protein binding (ISO,ISS)

kinase binding (IDA)

microtubule binding (IDA)

protein binding (IPI,ISO)

protein kinase inhibitor activity (IEA)

sodium:proton antiporter activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

amyotrophic lateral sclerosis pathway (IEA)

apoptotic cell death pathway (IEA)

B cell receptor signaling pathway (IEA)

calcium/calcium-mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

long term potentiation (IEA)

mitogen activated protein kinase signaling pathway (IEA)

T cell receptor signaling pathway (IEA)

tuberculosis pathway (IEA)

vascular endothelial growth factor signaling pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules.	Andrade J, etal., Biochem J. 2004 Dec 1;384(Pt 2):327-36.
2.	The EF-hand Ca2+-binding protein p22 plays a role in microtubule and endoplasmic reticulum organization and dynamics with distinct Ca2+-binding requirements.	Andrade J, etal., Mol Biol Cell. 2004 Feb;15(2):481-96. Epub 2003 Dec 2.
3.	A novel Ca2+-binding protein, p22, is required for constitutive membrane traffic.	Barroso MR, etal., J Biol Chem 1996 Apr 26;271(17):10183-7.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Prevalence of left and balanced coronary arterial dominance decreases with increasing age of patients at autopsy. A postmortem coronary angiograms study.	Knaapen M, etal., Cardiovasc Pathol. 2013 Jan-Feb;22(1):49-53. doi: 10.1016/j.carpath.2012.02.012. Epub 2012 Mar 30.
6.	The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP.	Kuwahara H, etal., J Biochem. 2003 Aug;134(2):245-50.
7.	A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger.	Matsumoto M, etal., J Biochem (Tokyo) 2001 Aug;130(2):217-25.
8.	Dual functional significance of calcineurin homologous protein 1 binding to Na(+)/H(+) exchanger isoform 1.	Matsushita M, etal., Am J Physiol Cell Physiol. 2011 Aug;301(2):C280-8. doi: 10.1152/ajpcell.00404.2010. Epub 2011 May 4.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Two nuclear export signals specify the cytoplasmic localization of calcineurin B homologous protein 1.	Nagita M, etal., J Biochem. 2003 Dec;134(6):919-25.
11.	KIF1Bbeta2, capable of interacting with CHP, is localized to synaptic vesicles.	Nakamura N, etal., J Biochem. 2002 Sep;132(3):483-91.
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	CFU-C in Agar.	Praloran V and Bartocci A, Methods Mol Biol. 1990;5:323-30. doi: 10.1385/0-89603-150-0:323.
15.	GOA pipeline	RGD automated data pipeline
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.	The EF-hand Ca(2+)-binding protein p22 associates with microtubules in an N-myristoylation-dependent manner.	Timm S, etal., Mol Biol Cell. 1999 Oct;10(10):3473-88.
19.	SLC9A9 mutations, gene expression, and protein-protein interactions in rat models of attention-deficit/hyperactivity disorder.	Zhang-James Y, etal., Am J Med Genet B Neuropsychiatr Genet. 2011 Dec;156B(7):835-43. doi: 10.1002/ajmg.b.31229. Epub 2011 Aug 19.

Additional References at PubMed

PMID:8901634	PMID:10593895	PMID:11350981	PMID:15035633	PMID:15489334	PMID:15987692	PMID:19056867	PMID:21085126	PMID:21423176	PMID:23376485	PMID:29379881

Genomics

Comparative Map Data

Chp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	106,536,009 - 106,571,255 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	106,536,004 - 106,571,251 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	110,213,376 - 110,248,697 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,808,913 - 118,844,244 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	116,469,312 - 116,504,631 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	111,354,506 - 111,389,998 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	111,354,506 - 111,389,989 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	117,902,988 - 117,938,480 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	106,066,389 - 106,101,635 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	105,962,816 - 105,998,059 (+)	NCBI
Celera	3	105,447,792 - 105,483,065 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

CHP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	41,231,268 - 41,281,887 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	15	41,230,839 - 41,281,887 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	41,523,466 - 41,574,085 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	39,310,729 - 39,361,377 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	39,310,728 - 39,361,373	NCBI
Celera	15	18,291,415 - 18,342,063 (+)	NCBI		Celera
Cytogenetic Map	15	q15.1	NCBI
HuRef	15	18,371,799 - 18,422,604 (+)	NCBI		HuRef
CHM1_1	15	41,641,426 - 41,692,297 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	39,037,454 - 39,088,066 (+)	NCBI		T2T-CHM13v2.0

Chp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	119,378,172 - 119,417,505 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	119,378,178 - 119,417,508 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	119,547,707 - 119,587,024 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	119,547,697 - 119,587,027 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	119,373,443 - 119,412,760 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	119,239,155 - 119,278,461 (+)	NCBI		MGSCv36	mm8
Celera	2	120,700,969 - 120,740,985 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI

Chp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	8,090,034 - 8,132,870 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	8,090,034 - 8,131,605 (+)	NCBI	ChiLan1.0	ChiLan1.0

CHP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	15	34,624,238 - 34,674,873 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	20,172,874 - 20,223,382 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	38,418,815 - 38,466,925 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	38,418,815 - 38,467,681 (+)	Ensembl	panpan1.1		panPan2

CHP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	8,304,939 - 8,352,833 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	8,305,007 - 8,350,904 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	8,363,447 - 8,409,616 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	8,438,344 - 8,484,537 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	8,438,397 - 8,486,280 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	8,359,874 - 8,408,027 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	8,467,375 - 8,515,299 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	8,598,734 - 8,645,069 (+)	NCBI		UU_Cfam_GSD_1.0

Chp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	86,763,916 - 86,812,248 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	4,611,252 - 4,660,359 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	4,611,980 - 4,660,320 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	130,073,928 - 130,112,751 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	130,073,919 - 130,112,461 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	145,221,139 - 145,259,701 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	41,734,698 - 41,785,273 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	41,733,063 - 41,785,586 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	99,207,184 - 99,258,544 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	8,431,996 - 8,474,458 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	8,431,999 - 8,474,458 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Chp1
161 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	369
Count of miRNA genes:	199
Interacting mature miRNAs:	263
Transcripts:	ENSRNOT00000056405
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat

Markers in Region

RH134406

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	3	q35	UniSTS

RH143965

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	5	q24	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB070350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U39875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000056405 ⟹ ENSRNOP00000053243

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	106,536,004 - 106,571,251 (+)	Ensembl
Rnor_6.0 Ensembl	3	111,354,506 - 111,389,989 (+)	Ensembl

RefSeq Acc Id:

NM_024139 ⟹ NP_077053

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	106,536,009 - 106,571,255 (+)	NCBI
Rnor_6.0	3	111,354,506 - 111,389,998 (+)	NCBI
Rnor_5.0	3	117,902,988 - 117,938,480 (+)	NCBI
RGSC_v3.4	3	106,066,389 - 106,101,635 (+)	RGD
Celera	3	105,447,792 - 105,483,065 (+)	RGD

Sequence:

show sequence

CCCTAGTTTCCCTCCCCGGGCCGCAGGAGAAACAGTGCCCTCTCCCTTCTTGACCCCTGGCCCT
TCCCTCCCTTATTCCCTCTTGCCGCCGCTGCTTCTGGCGCTGCCGCTCCCGGAGGAGCTCCCGT
CACGGTGATGGGGTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAG
GAGACTGGCTTTTCCCACAGTCAGATCACACGCCTGTACAGCCGCTTCACCAGCCTGGACAAAG
GGGAGAACGGAACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAACCCACT
GGGGGACCGGATCATCAATGCCTTCTTCTCAGAGGGAGAGGATCAGGTAAACTTCCGAGGATTC
ATGAGAACTTTGGCTCATTTCCGACCCATTGAGGATAACGAAAAGAGCAAAGATGTGAATGGAC
CGGAACCCCTCAACAGCCGGAGCAACAAACTGCACTTTGCTTTCAGACTTTATGACTTGGATAA
AGATGACAAGATCTCCCGCGATGAGCTGTTACAGGTACTGCGAATGATGGTCGGAGTGAATATC
TCAGATGAGCAGCTGGGCAGTATTGCAGACAGGACCATCCAGGAGGCTGACCAAGATGGAGACA
GTGCCATATCTTTTACAGAATTTGTTAAGGTTTTGGAGAAGGTGGATGTAGAACAGAAGATGAG
CATCCGATTTCTTCACTAAAGGGCAGAGACCAAATTATTCTTGCTTTCTAGTATTTAAGAACTG
AAACTTCCTTCTGTCCTCCAGCCCCACCCCATCCTGTCATCCCCCTTTCCCAGAATACTACAGC
TCCTGCATGACAACCTGAAGTCTCTCCTGTCCATACAAACTTGCCTTTGGTGTATAAACAGGGC
GTTACAGAATGGTACCCTGTCTATTTCTGTTCGGTATCCACCCATCAGTCTTTATTGTAAGTAC
CAACTTCCCCTGTTCTACTGCTCAGTGCCACGCATCCGTCCTGTCTGAGGAAAGAAACAGGGAC
TCATGTCAAGAACCAGCCAGCAAAGCTCCCACTAGATGGGACCATATCCATGCTGCCTTCCCTT
CATCAGCCCTCCATCATGGTCCTGTGTGCTGTGTCCTGTGTCCTGTGTCTGTTTCTTCCTACCT
CTCTGTCATCCAGCCTTCTCTCCATTCAGTCTTTCAGCTGTCCTCCTGTCGTTGAGATTCCCTG
CATTCTACTTGACTCTGGGCTCTGCTGGTAAGCCTGTTTCTGATGTGGCAGGATAGTTAGTGGT
CTGGTGATCTGTATCTACCTTCTGATGTGGGATATTGCCTATCCAGGAGCTATTGCTCTGTCGT
CACAGGGCTTATGAGCAGACATGTTCTTAAAAGGTAGTCATGGTGAGGCTTGTAGAGCCATGTC
TCCTAGGTGGCTTCCCAGGTCTCTCTACCTCTGACTTTTTATTTTCAAATATATTTATGTGGCT
TTTCTGGGTACAGTGTTGACATTCAGAAAATAGTCTAATGCCTGCCAGTTTGCTTCTCTTTGGG
ACATTGTCACCACCCAAGCGGCTGTTCTGACAATATGGTAGAGGGCCTTCTTGTGTTTTCTGAC
AAGGATGGGCACCCTGGAGAGCTGCCCACATTTGCTCCACAGCATGGGTTATGCCTCAGTGTTC
TGTACACTTGAAGATTCTTCACATTTCCAAACAGAAAGACTAGTGTTACAGAAGTGCCTGACTT
ACCTCAGTCCTAAAGAATTAGATTGTCCTCAGTGTCTTAAAGTTTTGCACAAAACTCTGAATGA
ATTTTATACTTGGCAAATTTTAATGCTGGAAGATGTATAGTCAGTTCATAATCCTGGTCCAGGC
ACTGTATGCATCGAATGTATTGTCTCATGAGCTTCCTAATGACACGACCTTCCTAGCTCCTTGT
GAATACTATACTATGCAGATCCCTCAGAAGCATGGGACCTGGGACTGGTGGCACCAACTGAGGT
GACATTCTCTGCCAATGTCAGCTTGATTTAGATGTCACTGAATCAAGCTGCTTCCGCCCTGTGT
TCCTGTGAATCTGCTCTTGGCTGGCTTTCTCTGGTGTTGCCTGCTTGCTTGCTTGCTTTGTTGC
TTTGGAAGGCTATCCAAGATATGTAAGCAATTCTTTAGGAAATAAATTGCTGTTAACCCAAACA
AACAAAAACACTGCAGACGAGATGGGTAAAGGCGAGCAGTGGGGGCGTGGCTAGGACAGATGGC
TAGGGTCTACATGAACTGGGGAATTCTTTATGAAATATGTCAGACTTTGTGATCAAATGATGTG
ATATAAGAATTGTATAAAGGGAATAATTGTCTGATACTTATCTGTTTGAGAAGTACTTCAGAAG
CATCTTGATTTAATTATTTAAAGTTTCTAAGATTATGCCCCCCTTGGCTGTATAGCAAACTGTT
TTTATCCACAGTTGTGCCTTATTGTCCCATTAAAATTGTATTCCTCAATCCACCAATAAATTAA
TTGTCGTTAAAACAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077053	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB04146	(Get FASTA)	NCBI Sequence Viewer
	AAH62029	(Get FASTA)	NCBI Sequence Viewer
	BAB63369	(Get FASTA)	NCBI Sequence Viewer
	EDL79910	(Get FASTA)	NCBI Sequence Viewer
	P61023	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_077053 ⟸ NM_024139
- UniProtKB:	Q62877 (UniProtKB/Swiss-Prot), P61023 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGD RIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDD KISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIR FLH hide sequence

RefSeq Acc Id:

ENSRNOP00000053243 ⟸ ENSRNOT00000056405

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P61023-F1-model_v2	AlphaFold	P61023	1-195	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692328

Promoter ID:

EPDNEW_R2852

Type:

initiation region

Name:

Chp1_1

Description:

calcineurin-like EF-hand protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	111,354,583 - 111,354,643	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620447	AgrOrtholog
BioCyc Gene	G2FUF-48200	BioCyc
Ensembl Genes	ENSRNOG00000004742	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000053243	ENTREZGENE
	ENSRNOP00000053243.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000056405	ENTREZGENE
	ENSRNOT00000056405.3	UniProtKB/Swiss-Prot
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5623922	IMAGE-MGC_LOAD
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:64152	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72429	IMAGE-MGC_LOAD
NCBI Gene	64152	ENTREZGENE
PANTHER	CALCINEURIN B HOMOLOGOUS PROTEIN 1	UniProtKB/Swiss-Prot
	EG:114D9.1 PROTEIN-RELATED	UniProtKB/Swiss-Prot
Pfam	EF-hand_7	UniProtKB/Swiss-Prot
PhenoGen	Chp1	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
SMART	EFh	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
UniProt	CHP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q62877	ENTREZGENE
UniProt Secondary	Q62877	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-07-16	Chp1	calcineurin-like EF-hand protein 1	Chp	calcium binding protein p22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Chp	calcium binding protein p22			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Chp	Chp			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the EF-hand family of Ca2+ binding proteins	724726

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)