Cga (glycoprotein hormones, alpha polypeptide)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cga (glycoprotein hormones, alpha polypeptide) Rattus norvegicus

Analyze

Symbol:

Cga

Name:

glycoprotein hormones, alpha polypeptide

RGD ID:

620436

Description:

Predicted to enable follicle-stimulating hormone activity. Predicted to be involved in several processes, including positive regulation of steroid biosynthetic process; regulation of signaling receptor activity; and thyroid hormone generation. Predicted to act upstream of or within several processes, including gonadotropin secretion; negative regulation of organ growth; and thyroid gland development. Predicted to be part of follicle-stimulating hormone complex. Predicted to be active in extracellular space. Orthologous to human CGA (glycoprotein hormones, alpha polypeptide); PARTICIPATES IN follicle-stimulating hormone signaling pathway; luteinizing hormone signaling pathway; autoimmune thyroiditis pathway; INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

anterior pituitary glycoprotein hormones common subunit alpha; follicle-stimulating hormone alpha chain; follitropin alpha chain; FSH-alpha; glycoprotein hormone alpha subunit; glycoprotein hormones alpha chain; glycoprotein hormones, alpha subunit; Gpa1; LSH-alpha; luteinizing hormone alpha chain; lutropin alpha chain; pituitary hormone; pituitary hormone alpha subunit; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain; TSH-alpha

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	49,486,915 - 49,499,192 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	49,487,068 - 49,499,191 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	51,680,297 - 51,692,413 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	53,280,529 - 53,292,645 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	53,182,409 - 53,194,594 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	50,362,491 - 50,393,368 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	50,381,244 - 50,393,367 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	54,950,198 - 54,962,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	51,538,259 - 51,550,324 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	51,538,437 - 51,550,503 (+)	NCBI
Celera	5	48,231,474 - 48,243,595 (+)	NCBI		Celera
RH 3.4 Map	5	269.7	RGD
Cytogenetic Map	5	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adrenal gland disease (ISO)

atrial fibrillation (ISO)

breast cancer (ISO)

Disease Progression (ISO)

Follicular Thyroid Cancer (ISO)

hemiplegia (ISO)

Hydatidiform Mole (ISO)

Leydig cell tumor (ISO)

Neoplasm Metastasis (ISO)

oligospermia (ISO)

ovarian disease (ISO)

prostate carcinoma (ISO)

uterine disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3',5'-cyclic AMP (EXP,ISO)

3,3',5-triiodo-L-thyronine (EXP)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (EXP,ISO)

acetaldehyde (ISO)

amiodarone (EXP)

anandamide (ISO)

androst-4-ene-3,17-dione (EXP)

arsenous acid (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

bifenthrin (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

butyric acid (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

colforsin daropate hydrochloride (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

cyanamide (ISO)

cyclosporin A (ISO)

cypermethrin (ISO)

DDE (ISO)

DDT (ISO)

decabromodiphenyl ether (EXP,ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dorsomorphin (ISO)

equol (EXP)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (EXP,ISO)

flufenamic acid (EXP)

flutamide (EXP)

fulvestrant (ISO)

iodoacetic acid (ISO)

ketoconazole (ISO)

lead diacetate (ISO)

methotrexate (ISO)

methoxychlor (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monosodium L-glutamate (EXP)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

nickel sulfate (EXP,ISO)

nicotine (ISO)

nimodipine (ISO)

Nonylphenol (EXP)

Octicizer (ISO)

octreotide (ISO)

pentanal (ISO)

perfluorobutanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

Phenelzine (EXP)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (EXP)

progesterone (EXP,ISO)

propanal (ISO)

prostaglandin E2 (EXP,ISO)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (EXP)

sodium perchlorate (EXP)

sophoraflavanone B (EXP)

T-2 toxin (ISO)

tamoxifen (ISO)

taurine (EXP,ISO)

tebuconazole (ISO)

testosterone (EXP,ISO)

testosterone enanthate (EXP)

thapsigargin (ISO)

theophylline (ISO)

thimerosal (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to hormone stimulus (ISO)

developmental growth (ISO)

follicle-stimulating hormone secretion (ISO)

G protein-coupled receptor signaling pathway (ISO,ISS)

gonad development (ISO)

luteinizing hormone secretion (ISO)

negative regulation of organ growth (ISO)

organ growth (ISO)

positive regulation of steroid biosynthetic process (IBA,ISO,ISS)

regulation of signaling receptor activity (ISO,ISS)

thyroid gland development (ISO)

thyroid hormone generation (IBA,ISO)

Cellular Component

extracellular space (IBA,ISO,ISS)

follicle-stimulating hormone complex (IBA,ISO,ISS)

pituitary gonadotropin complex (ISO)

Molecular Function

follicle-stimulating hormone activity (IBA,ISO,ISS)

hormone activity (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

autoimmune thyroiditis pathway (IEA)

follicle-stimulating hormone signaling pathway (ISO)

gonadotropin-releasing hormone signaling pathway (IEA)

luteinizing hormone signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Fetal but not adult Leydig cells are susceptible to adenoma formation in response to persistently high hCG level: a study on hCG overexpressing transgenic mice.	Ahtiainen P, etal., Oncogene. 2005 Nov 10;24(49):7301-9.
2.	Human chorionic gonadotropin and free subunits' serum levels in patients with partial and complete hydatidiform moles.	Berkowitz R, etal., Obstet Gynecol. 1989 Aug;74(2):212-6.
3.	CGA gene (coding for the alpha subunit of glycoprotein hormones) overexpression in ER alpha-positive prostate tumors.	Bieche I, etal., Eur Urol. 2002 Mar;41(3):335-41.
4.	The CGA gene as new predictor of the response to endocrine therapy in ER alpha-positive postmenopausal breast cancer patients.	Bieche I, etal., Oncogene. 2001 Oct 18;20(47):6955-9.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	alpha Subunit of rat pituitary glycoprotein hormones. Primary structure of the precursor determined from the nucleotide sequence of cloned cDNAs.	Godine JE, etal., J Biol Chem 1982 Jul 25;257(14):8368-71.
7.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Distribution and characterization of alpha hCG in the serum and tumor cytosol of patients with breast cancer.	Shindelman JE, etal., Int J Cancer. 1980 May 15;25(5):599-604.

Additional References at PubMed

PMID:2467841	PMID:2494176	PMID:11207219	PMID:12114718	PMID:12477932	PMID:20352046	PMID:21187122	PMID:22206666	PMID:23299500	PMID:24692546

Genomics

Comparative Map Data

Cga
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	49,486,915 - 49,499,192 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	49,487,068 - 49,499,191 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	51,680,297 - 51,692,413 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	53,280,529 - 53,292,645 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	53,182,409 - 53,194,594 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	50,362,491 - 50,393,368 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	50,381,244 - 50,393,367 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	54,950,198 - 54,962,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	51,538,259 - 51,550,324 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	51,538,437 - 51,550,503 (+)	NCBI
Celera	5	48,231,474 - 48,243,595 (+)	NCBI		Celera
RH 3.4 Map	5	269.7	RGD
Cytogenetic Map	5	q21	NCBI

CGA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	87,085,498 - 87,095,106 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	87,085,498 - 87,095,106 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	87,795,216 - 87,804,824 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	87,851,941 - 87,861,543 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	87,851,940 - 87,861,543	NCBI
Celera	6	88,213,978 - 88,223,577 (-)	NCBI		Celera
Cytogenetic Map	6	q14.3	NCBI
HuRef	6	85,012,102 - 85,021,750 (-)	NCBI		HuRef
CHM1_1	6	87,892,792 - 87,902,440 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	88,294,252 - 88,303,837 (-)	NCBI		T2T-CHM13v2.0

Cga
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	34,893,779 - 34,907,374 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	34,893,779 - 34,907,370 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	34,893,779 - 34,907,374 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	34,893,779 - 34,907,370 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	34,841,028 - 34,854,623 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	35,082,666 - 35,096,261 (+)	NCBI		MGSCv36	mm8
Celera	4	34,617,733 - 34,630,763 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	16.86	NCBI

Cga
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	14,092,743 - 14,095,302 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	14,092,743 - 14,168,297 (-)	NCBI	ChiLan1.0	ChiLan1.0

CGA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	105,061,393 - 105,071,234 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	84,962,974 - 84,972,638 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	88,237,550 - 88,247,051 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	88,236,206 - 88,247,300 (-)	Ensembl	panpan1.1		panPan2

CGA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	46,610,801 - 46,629,322 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	46,610,973 - 46,636,640 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	46,421,893 - 46,423,957 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	47,386,566 - 47,405,165 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	47,386,743 - 47,405,483 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	46,708,843 - 46,710,907 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	46,638,576 - 46,640,642 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	46,827,170 - 46,829,230 (-)	NCBI		UU_Cfam_GSD_1.0

Cga
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	81,774,384 - 81,791,558 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936510	4,679,321 - 4,696,529 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936510	4,679,349 - 4,696,511 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CGA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	55,551,320 - 55,568,991 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	55,552,675 - 55,569,057 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	62,245,797 - 62,262,149 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	1	p21	NCBI

CGA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	11,560,543 - 11,578,070 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	11,560,222 - 11,578,093 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	187,751,845 - 187,768,611 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cga
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624799	7,249,586 - 7,265,999 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624799	7,249,502 - 7,265,662 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cga
58 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	36
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000012385
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat

Markers in Region

RH139948

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	5	269.7	UniSTS
Cytogenetic Map	5	q13-q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium										3
Low	1							8	2	18
Below cutoff		7	2	3	2	1	1	27	16	12	3	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH003617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D00575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HF564726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000012385 ⟹ ENSRNOP00000012385

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	49,487,068 - 49,499,191 (+)	Ensembl
Rnor_6.0 Ensembl	5	50,381,244 - 50,393,367 (+)	Ensembl

RefSeq Acc Id:

NM_053918 ⟹ NP_446370

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	49,487,068 - 49,499,189 (+)	NCBI
Rnor_6.0	5	50,381,244 - 50,393,365 (+)	NCBI
Rnor_5.0	5	54,950,198 - 54,962,319 (+)	NCBI
RGSC_v3.4	5	51,538,259 - 51,550,324 (+)	RGD
Celera	5	48,231,474 - 48,243,595 (+)	NCBI

Sequence:

show sequence

GAACAATCGGAGACCAAGTTCCCCTCAGATCGACAATCAACTGCCCAGAACACATCCTTCCAAA
GATCCAGAGTTTGCAGGAGAGCTATGGATTGCTACAGAAGATATGCGGCTGTCATTCTGGTCAT
GCTGTCCATGGTCCTGCATATTCTTCATCCTCTTCCTGATGGAGACCTTATTATTCAGGGTTGT
CCAGAATGTAAACTAAAGGAAAACAAATACTTCTCCAAGCTGGGTGCCCCCATCTATCAGTGTA
TGGGCTGTTGCTTCTCCAGGGCATACCCGACTCCCGCAAGGTCCAAGAAGACAATGTTGGTTCC
AAAGAATATTACCTCGGAGGCCACGTGCTGTGTGGCCAAATCATTTACTAAGGCCACAGTGATG
GGAAACGCCAGAGTGGAGAACCACACGGACTGCCACTGTAGCACTTGTTACTACCACAAGTCGT
AGCTTCCATGTGTGCCAAGGGCTGCGCTGACGACTGCTGACCCGTGCGATGGCACTGAGTGTCG
CCACCTCCTCCTTACCAGACTTCTGACACGCTTCAGTCATACACTGCTGCTTTCCTGTCACATC
CCTTATACTTCAGTACCATCGACAGTCTCTTCTCATTAGGGGAAAATGTGTATCTACCATGGTC
CCATCAGAAATAAAGCCTTTTCAATCA

hide sequence

RefSeq Acc Id:

XM_039109158 ⟹ XP_038965086

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	49,486,915 - 49,499,192 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446370	(Get FASTA)	NCBI Sequence Viewer
	XP_038965086	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA97425	(Get FASTA)	NCBI Sequence Viewer
	AAB04669	(Get FASTA)	NCBI Sequence Viewer
	AAH63160	(Get FASTA)	NCBI Sequence Viewer
	BAA00453	(Get FASTA)	NCBI Sequence Viewer
	CCP37931	(Get FASTA)	NCBI Sequence Viewer
	EDL98607	(Get FASTA)	NCBI Sequence Viewer
	EDL98608	(Get FASTA)	NCBI Sequence Viewer
	EDL98609	(Get FASTA)	NCBI Sequence Viewer
	EDL98610	(Get FASTA)	NCBI Sequence Viewer
	P11962	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_446370 ⟸ NM_053918
- Peptide Label:	precursor
- UniProtKB:	P70516 (UniProtKB/Swiss-Prot), A0A0F7RQ24 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDCYRRYAAVILVMLSMVLHILHPLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRA YPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS hide sequence

RefSeq Acc Id:

ENSRNOP00000012385 ⟸ ENSRNOT00000012385

RefSeq Acc Id:	XP_038965086 ⟸ XM_039109158
- Peptide Label:	isoform X1
- UniProtKB:	P70516 (UniProtKB/Swiss-Prot), A0A0F7RQ24 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P11962-F1-model_v2	AlphaFold	P11962	1-120	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620436	AgrOrtholog
BioCyc Gene	G2FUF-41645	BioCyc
Ensembl Genes	ENSRNOG00000009269	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000012385	ENTREZGENE
	ENSRNOP00000012385.3	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012385	ENTREZGENE
	ENSRNOT00000012385.5	UniProtKB/Swiss-Prot
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6922315	IMAGE-MGC_LOAD
InterPro	Cystine-knot_cytokine	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hormone	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:116700	UniProtKB/TrEMBL
MGC_CLONE	MGC:72733	IMAGE-MGC_LOAD
NCBI Gene	116700	ENTREZGENE
PANTHER	GLYCOPROTEIN HORMONES ALPHA CHAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11509	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Hormone_6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cga	PhenoGen
PRINTS	GLYCOHORMONE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	GLYCO_HORMONE_ALPHA_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GLYCO_HORMONE_ALPHA_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GLYCO_HORMONE_ALPHA_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	GHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF57501	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0F7RQ24	ENTREZGENE, UniProtKB/TrEMBL
	GLHA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P70516	ENTREZGENE
	Q6P509_RAT	UniProtKB/TrEMBL
UniProt Secondary	P70516	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-02-04	Cga	glycoprotein hormones, alpha polypeptide	Cga	glycoprotein hormones, alpha subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Cga	glycoprotein hormones, alpha subunit			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Cga				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	precursor protein consists of a 24 amino acid leader sequence and a 96 amino acid alpha subunit apoprotein	632382

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)