Syt10 (synaptotagmin 10) - Rat Genome Database

Name: Syt10
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Syt10 (synaptotagmin 10) Rattus norvegicus

Analyze

Symbol:

Syt10

Name:

synaptotagmin 10

RGD ID:

62041

Description:

Predicted to enable several functions, including calcium ion sensor activity; phospholipid binding activity; and protein dimerization activity. Predicted to be involved in positive regulation of calcium ion-dependent exocytosis; presynaptic dense core vesicle exocytosis; and sensory perception of smell. Predicted to be located in synaptic vesicle membrane. Predicted to be active in several cellular components, including exocytic vesicle; glutamatergic synapse; and presynapse. Biomarker of visual epilepsy. Orthologous to human SYT10 (synaptotagmin 10); INTERACTS WITH 17beta-estradiol; ammonium chloride; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

synaptotagmin X; synaptotagmin-10; sytX

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SYT10 (synaptotagmin 10)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Syt10 (synaptotagmin X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Syt10 (synaptotagmin X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SYT10 (synaptotagmin 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	syt10 (synaptotagmin X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snt-5	Alliance	DIOPT (OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,737,301 - 122,800,462 (-)	NCBI		GRCr8
mRatBN7.2	7	120,857,698 - 120,920,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,862,972 - 120,920,863 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	122,661,274 - 122,718,960 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,887,410 - 124,945,103 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,819,888 - 124,879,596 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,769,039 - 130,827,030 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,768,841 - 130,827,152 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	130,452,003 - 130,510,388 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	128,115,443 - 128,174,355 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	128,149,672 - 128,208,585 (-)	NCBI
Celera	7	117,334,018 - 117,391,703 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

visual epilepsy (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-estradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chrysene (ISO)

cocaine (EXP)

dibutyl phthalate (EXP)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

glufosinate (ISO)

graphene oxide (ISO)

methamphetamine (EXP,ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (ISO)

PCB138 (ISO)

potassium dichromate (ISO)

tetraphene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium-ion regulated exocytosis (IBA)

chemical synaptic transmission (ISO,ISS)

positive regulation of calcium ion-dependent exocytosis (ISO,ISS)

presynaptic dense core vesicle exocytosis (ISO)

regulation of calcium ion-dependent exocytosis (ISO)

sensory perception of smell (ISO,ISS)

synaptic vesicle exocytosis (ISO,ISS)

Cellular Component

exocytic vesicle (IBA,ISO,ISS)

glutamatergic synapse (ISO)

membrane (IEA)

plasma membrane (IBA)

presynapse (ISO)

synaptic vesicle membrane (TAS)

Molecular Function

calcium ion binding (IBA,ISO,ISS)

calcium-dependent phospholipid binding (IBA)

clathrin binding (IBA)

identical protein binding (ISO)

phosphatidylinositol-4,5-bisphosphate binding (ISO)

phosphatidylserine binding (IBA,ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

SNARE binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A novel seizure-induced synaptotagmin gene identified by differential display.	Babity JM, etal., Proc Natl Acad Sci U S A 1997 Mar 18;94(6):2638-41.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10531343	PMID:10531344	PMID:12860971	PMID:21496647

Genomics

Comparative Map Data

Syt10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,737,301 - 122,800,462 (-)	NCBI		GRCr8
mRatBN7.2	7	120,857,698 - 120,920,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,862,972 - 120,920,863 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	122,661,274 - 122,718,960 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,887,410 - 124,945,103 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,819,888 - 124,879,596 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,769,039 - 130,827,030 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,768,841 - 130,827,152 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	130,452,003 - 130,510,388 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	128,115,443 - 128,174,355 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	128,149,672 - 128,208,585 (-)	NCBI
Celera	7	117,334,018 - 117,391,703 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

SYT10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	33,374,238 - 33,439,819 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	33,374,238 - 33,439,819 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	33,527,173 - 33,592,754 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	33,419,615 - 33,484,021 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	33,419,614 - 33,484,021	NCBI
Celera	12	13,335,630 - 13,400,035 (-)	NCBI		Celera
Cytogenetic Map	12	p11.1	NCBI
HuRef	12	33,268,030 - 33,332,379 (-)	NCBI		HuRef
CHM1_1	12	33,493,388 - 33,557,762 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	33,245,435 - 33,311,036 (-)	NCBI		T2T-CHM13v2.0

Syt10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	89,657,221 - 89,726,181 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	89,666,596 - 89,726,063 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	89,773,714 - 89,841,980 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	89,782,393 - 89,841,860 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	89,612,824 - 89,672,291 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	89,610,160 - 89,669,536 (-)	NCBI		MGSCv36	mm8
Celera	15	91,906,236 - 91,966,102 (-)	NCBI		Celera
Cytogenetic Map	15	E3	NCBI
cM Map	15	44.96	NCBI

Syt10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955505	2,403,055 - 2,449,528 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955505	2,392,086 - 2,449,528 (+)	NCBI	ChiLan1.0	ChiLan1.0

SYT10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	63,284,958 - 63,358,857 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	63,286,586 - 63,355,247 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	52,761,294 - 52,830,221 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	55,364,858 - 55,429,298 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	55,364,714 - 55,429,298 (+)	Ensembl	panpan1.1		panPan2

SYT10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	15,593,709 - 15,657,184 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	15,593,649 - 15,687,920 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	30,768,616 - 30,835,595 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	15,771,897 - 15,835,539 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	15,771,596 - 15,866,288 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	15,579,522 - 15,646,934 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	15,608,782 - 15,676,039 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	30,916,635 - 30,980,314 (-)	NCBI		UU_Cfam_GSD_1.0

Syt10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	76,107,495 - 76,166,270 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936607	2,940,466 - 2,994,344 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936607	2,940,607 - 2,995,178 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SYT10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	40,872,283 - 40,934,326 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	40,869,418 - 40,940,851 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	43,998,608 - 44,061,673 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SYT10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	32,846,425 - 32,914,946 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	32,850,902 - 32,914,464 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666069	1,957,798 - 2,024,004 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Syt10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624778	2,700,545 - 2,763,134 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Syt10
350 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	12
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000019406
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	119513385	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	116677189	127103496	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
1582240	Sffal1	Serum free fatty acids level QTL 1	3.4	0.0021	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	7	116677010	124049952	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

D7Got235

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	7	130,786,157 - 130,786,399	NCBI	Rnor6.0
Rnor_5.0	7	130,469,515 - 130,469,757	UniSTS	Rnor5.0
RGSC_v3.4	7	128,132,749 - 128,132,991	UniSTS	RGSC3.4
Celera	7	117,351,660 - 117,351,902	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	3	3	99	28	25	14	5	14	2	72	12	93	36	55	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF375463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ437524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U85513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019406 ⟹ ENSRNOP00000019406

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	120,864,997 - 120,920,863 (-)	Ensembl
Rnor_6.0 Ensembl	7	130,768,841 - 130,827,152 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098923 ⟹ ENSRNOP00000091005

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	120,862,972 - 120,920,863 (-)	Ensembl

RefSeq Acc Id:

NM_031666 ⟹ NP_113854

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,737,301 - 122,800,462 (-)	NCBI
mRatBN7.2	7	120,857,698 - 120,920,863 (-)	NCBI
Rnor_6.0	7	130,769,039 - 130,827,030 (-)	NCBI
Rnor_5.0	7	130,452,003 - 130,510,388 (-)	NCBI
RGSC_v3.4	7	128,115,443 - 128,174,355 (-)	RGD
Celera	7	117,334,018 - 117,391,703 (-)	RGD

Sequence:

show sequence

ATGAGTTTCCGCAAGGAGGACGGGGTGAGCAGCCTGTGCCAGAAGGCGCTGCACATCATCACCG
AGCTGTGCTTCGCGGGCCAGGTGGAGTGGGACAAGTGTTCGGGCATCTTTCCAGCCGATAGGAG
CGGCCAGGGCGGAGGTGGCACAGACATTTCAGTCAGCCTGTTAGCAGTTGTTGTAAGCTTCTGT
GGCCTGGCCCTGCTGGTTGTCTCCCTTTTCGTCTTCTGGAAGTTGTGCTGGCCCTGCTGGAAGA
GCAAGCTCGTGGCCCCCAATGTCAGTACCCTTCCGCAGAGCATCTCAAGTGCTCCAACTGAGGT
TTTTGAGACCGAAGAGAAAAAAGAAGTCGAAGAAAATGAAAAGCCAGCACCAAAAGCTATTGAG
CCTGCAATAAAAATCAGCCACACATCCCCCGACATCCCAGCAGAAGTGCAAACTGCTTTAAAGG
AGCATTTAATTAAACATGCCCGTGTGCAGAGGCAAACGACCGATCCTACATCTTCATCCCGCCA
CAATTCCTTCAGGAGGCACCTACCAAGGCAAATGAACGTCTCCAGTGTTGACTTTAGCATGGGC
ACGGAACCTGTCTTACAAAGAGGAGAAACCAGAACCAGCATCGGGAGGATAAAACCGGAACTCT
ATAAGCAGAAATCAGTTGACTCCGAGGGCAACAGAAAAGACGACGTCAAAACCTGTGGGAAACT
TAACTTTGCGCTCCAGTACGATTATGAAAATGAACTCCTAGTTGTTAAAATTATCAAAGCTCTA
GATCTCCCAGCTAAAGATTTCACAGGAACTTCTGATCCTTATGTGAAGATCTATCTTCTTCCGG
ACAGGAAGAAGAAATTTCAGACCCGTGTGCACCGGAAGACTTTAAACCCTCTGTTCGATGAGCT
ATTTCAGTTCCCGGTGGTTTACGATCAGCTAAGCAACCGCAAATTACACTTTAGTATATATGAT
TTTGACAGATTTTCCAGACACGACATGATTGGGGAAGTGATTCTTGATAATTTATTTGAAGTCT
CTGATCTCTCCAGGGAAGCCACAGTATGGAAAGATATCCACTGTGCAACCACAGAAAGCATAGA
CCTGGGCGAAATCATGTTTTCCCTTTGCTATTTGCCAACTGCTGGTCGCATGACCTTGACTGTG
ATCAAGTGCAGAAATCTGAAGGCAATGGACATTACCGGATCATCAGATCCTTATGTCAAAGTGT
CTCTGATGTGTGAGGGCCGAAGACTTAAAAAAAGAAAAACAACTACAAAGAAAAATACTCTCAA
TCCCGTGTACAATGAAGCCATTATTTTCGATATCCCTCCAGAAAATGTGGACCAGGTCAGCCTG
TGCATTGCGGTCATGGATTATGACAGGGTGGGACACAATGAGGTCATAGGTGTGTGTCGAACTG
GACTTGACGCTGAGGGTCTTGGAAGAGACCATTGGAATGAAATGCTGGCCTATCACCGAAAGCC
AATCACACACTGGCACCCCTTGCTGGAGTTACCTGGCCGAGCAACCAGTTTTGACAGTCAAGGA
TCCTGTTCTTCTCCCAGGCCACCGTCCACACCATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113854	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB51686	(Get FASTA)	NCBI Sequence Viewer
	AAK56958	(Get FASTA)	NCBI Sequence Viewer
	ABD83941	(Get FASTA)	NCBI Sequence Viewer
	EDL76586	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019406.2
	ENSRNOP00000091005.1
	ENSRNOP00055016728
	ENSRNOP00060036279
	ENSRNOP00065022994
GenBank Protein	O08625	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113854 ⟸ NM_031666

- UniProtKB:

Q925B8 (UniProtKB/Swiss-Prot), O08625 (UniProtKB/Swiss-Prot), A6K7P3 (UniProtKB/TrEMBL), Q1W5B9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSFRKEDGVSSLCQKALHIITELCFAGQVEWDKCSGIFPADRSGQGGGGTDISVSLLAVVVSFC
GLALLVVSLFVFWKLCWPCWKSKLVAPNVSTLPQSISSAPTEVFETEEKKEVEENEKPAPKAIE
PAIKISHTSPDIPAEVQTALKEHLIKHARVQRQTTDPTSSSRHNSFRRHLPRQMNVSSVDFSMG
TEPVLQRGETRTSIGRIKPELYKQKSVDSEGNRKDDVKTCGKLNFALQYDYENELLVVKIIKAL
DLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVHRKTLNPLFDELFQFPVVYDQLSNRKLHFSIYD
FDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTV
IKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSL
CIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRKPITHWHPLLELPGRATSFDSQG
SCSSPRPPSTP

hide sequence

Ensembl Acc Id:

ENSRNOP00000019406 ⟸ ENSRNOT00000019406

Ensembl Acc Id:

ENSRNOP00000091005 ⟸ ENSRNOT00000098923

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O08625-F1-model_v2	AlphaFold	O08625	1-523	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:62041	AgrOrtholog
BioCyc Gene	G2FUF-32417	BioCyc
Ensembl Genes	ENSRNOG00000014296	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055012196	UniProtKB/Swiss-Prot
	ENSRNOG00060025239	UniProtKB/Swiss-Prot
	ENSRNOG00065017388	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019406.4	UniProtKB/TrEMBL
	ENSRNOT00000098923.1	UniProtKB/Swiss-Prot
	ENSRNOT00055020742	UniProtKB/Swiss-Prot
	ENSRNOT00060043735	UniProtKB/Swiss-Prot
	ENSRNOT00065029030	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	C2_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C2_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Synaptotagmin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:60567	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	60567	ENTREZGENE
PANTHER	PTHR10024:SF46	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNAPTOTAGMIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PF00168	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Syt10	PhenoGen
PRINTS	C2DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNAPTOTAGMN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	PS50004	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014296	RatGTEx
	ENSRNOG00055012196	RatGTEx
	ENSRNOG00060025239	RatGTEx
	ENSRNOG00065017388	RatGTEx
SMART	SM00239	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49562	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QAR7_RAT	UniProtKB/TrEMBL
	A6K7P3	ENTREZGENE, UniProtKB/TrEMBL
	O08625	ENTREZGENE
	Q1W5B9	ENTREZGENE, UniProtKB/TrEMBL
	Q925B8	ENTREZGENE
	SYT10_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q925B8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Syt10	synaptotagmin 10	Syt10	synaptotagmin X	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Syt10	synaptotagmin X		synaptotagmin 10	Name updated	1299863	APPROVED
2002-06-10	Syt10	synaptotagmin 10			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression induces in degenerating hippocampus and piriform cortex following kainic acid-induced seizure activity	61761

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message