Advanced Search (OLGA)

Gene: Nfe2l2 (NFE2 like bZIP transcription factor 2) Rattus norvegicus

Analyze

Symbol:

Nfe2l2

Name:

NFE2 like bZIP transcription factor 2

RGD ID:

620360

Description:

Enables transcription cis-regulatory region binding activity and transcription coregulator binding activity. Involved in several processes, including aflatoxin catabolic process; positive regulation of macromolecule biosynthetic process; and regulation of cell migration. Located in nucleus. Used to study diabetic retinopathy; liver disease (multiple); middle cerebral artery infarction; myocardial infarction; and pulmonary fibrosis. Biomarker of several diseases, including extrahepatic cholestasis; kidney failure (multiple); metabolic dysfunction-associated steatohepatitis; neurodegenerative disease (multiple); and traumatic brain injury. Human ortholog(s) of this gene implicated in Alzheimer's disease; cataract; hepatocellular carcinoma; macular degeneration; and tuberculosis. Orthologous to human NFE2L2 (NFE2 like bZIP transcription factor 2); PARTICIPATES IN oxidative stress response pathway; nuclear factor, erythroid 2 like 2 signaling pathway; Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH (+)-taxifolin; (-)-selegiline; (R)-carnitine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

NF-E2-related factor 2; NFE2-related factor 2; nrf2; nuclear factor erythroid 2-like 2; nuclear factor erythroid 2-related factor 2; nuclear factor, erythroid 2-like 2; nuclear factor, erythroid derived 2, like 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Nfe2l2^em1Mcwi Nfe2l2^em1Kyo Nfe2l2^em2Kyo

Genetic Models:

SD-Nfe2l2^em1Mcwi SD-Nfe2l2^em1Mcwi-/- F344-Nfe2l2^em2Kyo F344-Nfe2l2^em1Kyo

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,001,529 - 81,031,165 (-)	NCBI		GRCr8
mRatBN7.2	3	60,594,239 - 60,621,712 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,594,242 - 60,621,737 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	63,968,507 - 63,995,961 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,552,163 - 72,579,616 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,318,419 - 70,345,871 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,497,568 - 62,525,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,497,571 - 62,524,996 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,041,641 - 69,069,190 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	58,366,693 - 58,394,116 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	58,263,064 - 58,290,488 (-)	NCBI
Celera	3	60,095,041 - 60,122,464 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acidoses (ISO)

acute kidney failure (IEP,ISO)

Acute Lung Injury (ISO)

Alcoholic Liver Diseases (ISO)

allergic contact dermatitis (ISO)

Alzheimer's disease (IEP,ISO)

amyotrophic lateral sclerosis (ISO)

Animal Disease Models (ISO)

asthma (ISO)

Birth Weight (ISO)

Brain Injuries (IEP)

Breast Neoplasms (ISO)

Carcinogenesis (ISO)

Cardiac Fibrosis (IEP)

Cardiac Output, Low (ISO)

Cardiomegaly (IEP)

cataract (ISO)

Chemical and Drug Induced Liver Injury (IEP,ISO)

cholestasis (ISO)

Chromosome Breakage (ISO)

chronic kidney disease (IEP)

chronic obstructive pulmonary disease (IEP,ISO)

Chronic Tubulointerstitial Nephropathy (IEP)

colitis (ISO)

colorectal cancer (IEP,ISO)

congestive heart failure (IEP,ISO)

Diabetic Cardiomyopathies (IEP,ISO)

Diabetic Nephropathies (IDA,IEP,ISO)

diabetic retinopathy (IDA)

Disease Progression (ISO)

Emphysema (ISO)

endocrine system disease (ISO)

Endometrial Neoplasms (ISO)

Endotoxemia (IEP)

esophagus squamous cell carcinoma (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

Experimental Colitis (IEP)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Mammary Neoplasms (IEP)

Experimental Seizures (IDA,ISO)

extrahepatic cholestasis (IEP,ISO)

Fetal Death (ISO)

Fetal Growth Retardation (IEP,ISO)

Fetal Weight (ISO)

gastrointestinal system disease (ISO)

genital herpes (ISO)

glucose intolerance (ISO)

Hepatic Insufficiency (ISO)

hepatocellular carcinoma (ISO)

Hepatomegaly (ISO)

Huntington's disease (IEP)

hyperglycemia (ISO)

Hyperplasia (ISO)

hypertension (IEP,ISO)

IMMUNODEFICIENCY, DEVELOPMENTAL DELAY, AND HYPOHOMOCYSTEINEMIA (ISO)

Insulin Resistance (ISO)

keratosis (ISO)

kidney disease (ISO)

Kidney Reperfusion Injury (IEP)

liver cirrhosis (IDA,ISO)

Liver Neoplasms (ISO)

Liver Reperfusion Injury (IEP)

lung cancer (ISO)

lung disease (ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

macular degeneration (ISO)

metabolic dysfunction-associated steatohepatitis (IEP)

metabolic dysfunction-associated steatotic liver disease (IDA,ISO)

Micronuclei, Chromosome-Defective (ISO)

middle cerebral artery infarction (IDA)

myocardial infarction (IDA,ISO)

Myocardial Reperfusion Injury (ISO)

Necrosis (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

Neurodevelopmental Disorders (ISO)

obesity (ISO)

pancreatic ductal carcinoma (ISO)

pleurisy (ISO)

Premature Aging (ISO)

primary biliary cholangitis (ISO)

primary ovarian insufficiency (ISO)

Prostatic Neoplasms (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (IDA,ISO)

renal cell carcinoma (ISO)

sickle cell anemia (ISO)

Skin Neoplasms (ISO)

Spinal Cord Injuries (IDA)

Splenomegaly (ISO)

split hand-foot malformation 5 (ISO)

squamous cell carcinoma (ISO)

steatotic liver disease (ISO)

Subarachnoid Hemorrhage (IEP)

Sunburn (ISO)

toxic encephalopathy (ISO)

traumatic brain injury (IEP)

tuberculosis (ISO)

type 2 diabetes mellitus (IEP)

Vascular System Injuries (ISO)

Ventricular Dysfunction, Left (ISO)

Ventricular Remodeling (ISO)

visceral leishmaniasis (ISO)

vitiligo (ISO)

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-albicanol (ISO)

(+)-alpha-viniferin (ISO)

(+)-beta-thujone (ISO)

(+)-catechin (ISO)

(+)-epicatechin-3-O-gallate (ISO)

(+)-isoborneol (ISO)

(+)-pilocarpine (ISO)

(+)-schisandrin B (ISO)

(+)-taxifolin (EXP,ISO)

(+)-trans-(S)-allethrin (ISO)

(-)-ephedrine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(-)-selegiline (EXP,ISO)

(1->4)-beta-D-glucan (ISO)

(E)-cinnamyl alcohol (ISO)

(R)-camphor (ISO)

(R)-carnitine (EXP)

(R)-linalyl acetate (ISO)

(R)-lipoic acid (EXP,ISO)

(R)-noradrenaline (EXP)

(R,R,R)-alpha-tocopherol (EXP,ISO)

(S)-colchicine (ISO)

(S)-duloxetine hydrochloride (ISO)

(S)-naringenin (ISO)

(S)-ropivacaine (ISO)

(Z)-ligustilide (ISO)

1,1'-azobis(N,N-dimethylformamide) (ISO)

1,2,3-Trichloropropane (ISO)

1,2-dibromoethane (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1,2-naphthoquinone (ISO)

1,3-dichloropropan-2-ol (EXP,ISO)

1,4,7-triazonane (ISO)

1,4-benzoquinone (ISO)

1,4-dichlorobenzene (ISO)

1,4-dithiothreitol (ISO)

1,4-naphthoquinone (ISO)

1,4-phenylenediamine (ISO)

1,8-cineole (ISO)

1-Amino-2,4-dibromoanthraquinone (ISO)

1-benzofuran (ISO)

1-bromopropane (EXP,ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (ISO)

1-nitropyrene (ISO)

1-octadec-9-enoylglycero-3-phosphate (ISO)

1-tert-Butoxy-2-propanol (ISO)

13,14-dihydro-Delta(12)-prostaglandin J2 (EXP)

15-deoxy-Delta(12,14)-prostaglandin J2 (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

1H-pyrazole (ISO)

2''-galloylhyperin (ISO)

2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2-Bis(bromomethyl)propane-1,3-diol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-dinitrobromobenzene (ISO)

2,4-dinitroiodobenzene (ISO)

2,4-dinitrotoluene (EXP)

2,5-di-tert-butylbenzene-1,4-diol (ISO)

2,5-dihydroxybenzoic acid (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2,6-dinitrotoluene (EXP)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP,ISO)

2-(chloromethyl)pyridine (ISO)

2-acetamidofluorene (ISO)

2-amino-2-deoxy-D-galactopyranose (EXP,ISO)

2-amino-3-hydroxypyridine (ISO)

2-aminoethoxydiphenylborane (ISO)

2-chloroethanol (EXP)

2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (EXP)

2-hydroxyethyl methacrylate (ISO)

2-methylcholine (ISO)

2-tert-butylhydroquinone (EXP,ISO)

20-hydroxyecdysone (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (EXP,ISO)

3,3'-diindolylmethane (ISO)

3,4-dihydroxybenzoic acid (EXP,ISO)

3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO)

3,6-diaminoacridine (ISO)

3-chloropropane-1,2-diol (EXP,ISO)

3-hydroxybutyric acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methoxycatechol (ISO)

3-methylcatechol (ISO)

3-methylcholanthrene (ISO)

3-Nitrobenzanthrone (ISO)

3-Nitrofluoranthene (ISO)

3-nitropropanoic acid (EXP)

3-O-Caffeoyl-1-O-methylquinic acid (ISO)

3-phenylprop-2-enal (ISO)

3H-1,2-dithiole-3-thione (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4,6-dioxoheptanoic acid (ISO)

4-hydroxy-TEMPO (EXP,ISO)

4-Hydroxybenzyl isothiocyanate (EXP)

4-hydroxyestrone (ISO)

4-hydroxynon-2-enal (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

4-methylcatechol (ISO)

4-nitrobenzaldehyde (ISO)

4-phenylbutyric acid (EXP,ISO)

5-aminolevulinic acid (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (EXP,ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP,ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (EXP)

7,12-dimethyltetraphene (EXP,ISO)

7,8-dihydroxycoumarin (ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO)

8-(4-chlorophenylthio)-cAMP (ISO)

9,10-phenanthroquinone (ISO)

9-cis-retinoic acid (EXP,ISO)

[6]-Shogaol (ISO)

abamectin (EXP)

acetic acid (EXP)

acrolein (EXP,ISO)

acrylamide (EXP,ISO)

actinomycin D (ISO)

Aescin (ISO)

aflatoxin B1 (EXP,ISO)

AL 8810 (ISO)

alachlor (ISO)

aldehydo-D-glucose (EXP,ISO)

aldosterone (EXP)

all-trans-retinal (ISO)

all-trans-retinoic acid (EXP,ISO)

allethrin (EXP)

allicin (ISO)

alloxan (EXP)

allyl isothiocyanate (EXP,ISO)

allyl methyl disulfide (ISO)

alogliptin (EXP)

alpha-D-galactose (EXP,ISO)

alpha-linolenic acid (EXP,ISO)

alpha-pinene (ISO)

alternariol (ISO)

Altertoxin II (ISO)

aluminium atom (EXP)

aluminium hydroxide (ISO)

aluminium(0) (EXP)

aminoguanidine (ISO)

amiodarone (ISO)

amitraz (EXP)

amlexanox (ISO)

ammonia (ISO)

ammonium chloride (EXP,ISO)

Ammothamnine (EXP,ISO)

amphetamine (EXP)

andrographolide (EXP,ISO)

anethole (EXP)

angelica lactone (ISO)

angiotensin II (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

anthranilic acid (ISO)

antimycin A (ISO)

apigenin (EXP)

apocynin (EXP,ISO)

aprepitant (EXP)

arachidonic acid (EXP)

arachidonyl-2'-chloroethylamide (ISO)

aristolochic acid A (EXP,ISO)

aristolochic acids (EXP)

Aroclor 1254 (ISO)

arsane (EXP,ISO)

arsenic acid (ISO)

arsenic atom (EXP,ISO)

arsenic trichloride (ISO)

arsenite(3-) (ISO)

arsenous acid (EXP,ISO)

artesunate (ISO)

asperuloside (ISO)

astaxanthin (EXP,ISO)

astilbin (ISO)

astragaloside IV (ISO)

Atipamezole (EXP)

atorvastatin calcium (EXP,ISO)

ATP (ISO)

atrazine (EXP,ISO)

auranofin (ISO)

auraptene (ISO)

aureusidin (EXP,ISO)

azathioprine (ISO)

Azoxymethane (ISO)

bafilomycin A1 (ISO)

baicalin (ISO)

BAPTA (ISO)

Bardoxolone methyl (EXP,ISO)

bathocuproine disulfonic acid (ISO)

bendiocarb (ISO)

benfotiamine (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

benzopyran (EXP)

benzoquinones (ISO)

benzyl isothiocyanate (EXP,ISO)

beraprost (ISO)

berberine (EXP,ISO)

Bergenin (EXP,ISO)

beta-carboline (ISO)

beta-naphthoflavone (ISO)

beta-propiolactone (ISO)

beta-tocopherol (EXP)

Betanin (EXP)

betulin (EXP)

bezafibrate (ISO)

bifenthrin (EXP,ISO)

bilirubin IXalpha (ISO)

biochanin A (ISO)

biphenyl-4-amine (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisdemethoxycurcumin (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

bisphenol AF (ISO)

bisphenol F (ISO)

bixin (ISO)

bleomycin A2 (EXP,ISO)

boric acid (ISO)

bortezomib (EXP,ISO)

brefeldin A (ISO)

bromobenzene (ISO)

Bromochloroacetonitrile (ISO)

bromocriptine (ISO)

bromosulfophthalein (ISO)

Brusatol (EXP,ISO)

bucladesine (ISO)

buspirone (EXP)

busulfan (ISO)

but-2-en-4-olide (ISO)

butane-2,3-dione (EXP)

butein (ISO)

butylated hydroxyanisole (EXP,ISO)

Butylbenzyl phthalate (ISO)

butyric acid (ISO)

C.I. Natural Red 20 (ISO)

cadmium acetate (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium telluride (ISO)

cafestol (EXP,ISO)

caffeine (EXP)

calciol (EXP,ISO)

calcitriol (ISO)

calcium atom (ISO)

calcium(0) (ISO)

calycosin (EXP)

calyculin a (ISO)

camphor (ISO)

camptothecin (ISO)

cannabidiol (ISO)

capsaicin (ISO)

carbamazepine (ISO)

carbendazim (EXP,ISO)

carbimazole (EXP)

carbon disulfide (EXP)

carbon monoxide (EXP,ISO)

carfilzomib (ISO)

carmustine (ISO)

carnosic acid (ISO)

Carnosol (ISO)

carrageenan (EXP)

carteolol (ISO)

carvacrol (EXP)

catalpol (ISO)

CCCP (ISO)

cefuroxime (ISO)

celastrol (EXP,ISO)

ceric oxide (ISO)

cerium (ISO)

ceruletide (ISO)

chalcone (ISO)

chalcones (EXP)

chenodeoxycholic acid (ISO)

chitosan (EXP,ISO)

chlorambucil (ISO)

chlormidazole (ISO)

chloroacetaldehyde (ISO)

Chloroacetonitrile (ISO)

chlorogenic acid (ISO)

chloropicrin (ISO)

chlorpromazine (EXP)

chlorpyrifos (EXP,ISO)

cholesterol (EXP)

cholic acid (ISO)

choline (ISO)

chromium atom (ISO)

chromium(6+) (EXP,ISO)

chrysin (EXP,ISO)

cidofovir anhydrous (ISO)

cilostazol (EXP,ISO)

cinnamyl alcohol (ISO)

ciprofibrate (ISO)

cisplatin (EXP,ISO)

citraconic acid (ISO)

clodronic acid (ISO)

clofibrate (EXP,ISO)

clorgyline (ISO)

clozapine (ISO)

cobalt atom (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

coenzyme Q10 (EXP,ISO)

colistin (EXP,ISO)

coniferyl aldehyde (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

cordycepin (EXP,ISO)

corilagin (ISO)

corn oil (ISO)

cortisol (EXP,ISO)

cortisone (EXP,ISO)

corynoline (ISO)

coumarin (ISO)

creatinine (ISO)

crocin-1 (EXP)

crotonaldehyde (ISO)

cumene hydroperoxide (ISO)

Cuprizon (EXP)

curcumin (EXP,ISO)

cyanidin cation (EXP,ISO)

cyanocob(III)alamin (ISO)

cycloheximide (ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyfluthrin (ISO)

cyhalothrin (EXP)

cylindrospermopsin (ISO)

Cynaropicrin (ISO)

cypermethrin (EXP,ISO)

cyproconazole (ISO)

cyproterone acetate (ISO)

D-glucose (EXP,ISO)

D-penicillamine (EXP)

dapagliflozin (EXP)

dazomet (ISO)

DDE (ISO)

DDT (ISO)

decabromodiphenyl ether (ISO)

delta-tocopherol (EXP)

demethoxycurcumin (ISO)

Dendrobine (ISO)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

desferrioxamine B (EXP,ISO)

desipramine (ISO)

dexamethasone (EXP,ISO)

dexmedetomidine (EXP,ISO)

dextran sulfate (ISO)

dextromethorphan (ISO)

Di-n-octyl phthalate (ISO)

diallyl disulfide (EXP,ISO)

Diallyl sulfide (EXP,ISO)

diallyl trisulfide (EXP,ISO)

diarsenic trioxide (EXP,ISO)

dibenziodolium (ISO)

dibenzofurans (ISO)

Dibromoacetonitrile (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichloroacetic acid (ISO)

Dichloroacetonitrile (ISO)

dichloroacetyl chloride (ISO)

dichloromethane (ISO)

dichlorvos (ISO)

diclofenac (EXP,ISO)

dicyclanil (ISO)

diethyl maleate (EXP,ISO)

diethyl phthalate (ISO)

diethylstilbestrol (EXP)

dihydroactinidiolide (ISO)

dihydroartemisinin (ISO)

dihydrolipoic acid (EXP)

dihydroxyacetone (ISO)

diisobutyl phthalate (ISO)

Diisodecyl phthalate (ISO)

diisononyl phthalate (ISO)

Dimerumic acid (ISO)

dimethomorph (ISO)

dimethyl fumarate (EXP,ISO)

dimethyl sulfoxide (EXP,ISO)

dimethylarsinic acid (ISO)

dioscin (EXP)

diosmetin (EXP)

dioxygen (EXP,ISO)

diphenyl diselenide (EXP)

diprotium oxide (ISO)

diquat (ISO)

disodium selenite (EXP,ISO)

dithionite(2-) (ISO)

diuron (EXP)

dorsomorphin (EXP,ISO)

doxorubicin (EXP,ISO)

echinacoside (EXP,ISO)

edaravone (EXP,ISO)

elemental selenium (EXP,ISO)

ellagic acid (EXP,ISO)

emodin (EXP,ISO)

enalapril (EXP)

endosulfan (EXP)

epalrestat (ISO)

epoxiconazole (ISO)

epoxomicin (ISO)

erastin (EXP,ISO)

erdosteine (EXP,ISO)

ergosta-4,6,8(14),22-tetraen-3-one (ISO)

eriodictyol (EXP,ISO)

erythromycin A (ISO)

esculetin (ISO)

etacrynic acid (ISO)

ethanol (EXP,ISO)

ethionamide (ISO)

ethoxyquin (ISO)

Ethyl phenylglycidate (ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

ethylene glycol dimethacrylate (ISO)

etoposide (ISO)

eugenol (ISO)

falcarindiol (EXP)

farnesol (EXP)

farrerol (ISO)

fenofibrate (EXP,ISO)

fenpyroximate (ISO)

fenvalerate (EXP)

ferroheme b (ISO)

ferrostatin-1 (EXP,ISO)

ferulic acid (ISO)

fisetin (EXP,ISO)

flufenacet (ISO)

fluoranthene (ISO)

fluorescein 5-isothiocyanate (ISO)

fluoxastrobin (ISO)

fluoxetine (EXP,ISO)

flutamide (EXP,ISO)

flutriafol (EXP,ISO)

fluvastatin (EXP)

folic acid (ISO)

formaldehyde (ISO)

formetanate (ISO)

formononetin (ISO)

Forsythiaside (ISO)

fructose (EXP,ISO)

fulvestrant (EXP,ISO)

fumonisin B1 (ISO)

furan (ISO)

furazolidone (ISO)

furosemide (ISO)

Fusaric acid (ISO)

gadolinium atom (ISO)

gadolinium trichloride (ISO)

galactose (EXP,ISO)

galangin (EXP,ISO)

galanthamine (EXP)

galanthamine Trifluoroacetic acid (EXP)

gallic acid (EXP,ISO)

gallium nitrate (ISO)

gallocatechin (ISO)

gamma-hexachlorocyclohexane (EXP)

gamma-tocopherol (EXP,ISO)

Gastrodin (EXP,ISO)

gemcitabine (ISO)

Genipin (ISO)

genistein (EXP,ISO)

gentamycin (EXP)

Geraniin (ISO)

geraniol (EXP,ISO)

Gingerenone A (ISO)

ginkgolide B (ISO)

Ginkgolide C (EXP)

ginsenoside Rb1 (ISO)

ginsenoside Rg1 (ISO)

Ginsenoside Rh4 (EXP,ISO)

gliclazide (EXP)

glucoraphanin (ISO)

glucose (EXP,ISO)

glutathione (EXP,ISO)

glutathione disulfide (ISO)

Glutathione ethyl ester (ISO)

glyburide (EXP)

glycine betaine (EXP,ISO)

glycogen (ISO)

glycyrrhetinate (EXP,ISO)

glycyrrhetinic acid (EXP,ISO)

glyphosate (EXP,ISO)

gold atom (ISO)

gold(0) (ISO)

gossypin (EXP)

guggulsterone (ISO)

GW 501516 (ISO)

harman (ISO)

heme b (ISO)

hemin (EXP,ISO)

heparin (ISO)

hesperetin (ISO)

hesperidin (EXP)

hexachlorobenzene (ISO)

hexadecanoic acid (ISO)

homocysteine (EXP,ISO)

homoeriodictyol (ISO)

hydrogen chloride (EXP,ISO)

hydrogen peroxide (EXP,ISO)

hydrogen sulfide (EXP,ISO)

hydroquinone (ISO)

hydroquinone O-beta-D-glucopyranoside (EXP)

hydroquinones (ISO)

hydroxysafflor yellow A (ISO)

hydroxyurea (ISO)

hypochlorous acid (ISO)

hypoxanthine (ISO)

iberin (EXP)

ibuprofen (ISO)

ifosfamide (EXP,ISO)

Ile(5)-angiotensin II (ISO)

imidacloprid (EXP)

imperatorin (ISO)

indirubin (EXP)

indole-3-methanol (EXP,ISO)

indolin-2-one (ISO)

indoline (EXP)

indometacin (EXP,ISO)

inositol (EXP)

iodoform (ISO)

ionomycin (ISO)

irinotecan (ISO)

iron atom (EXP,ISO)

iron dextran (EXP)

iron dichloride (ISO)

iron trichloride (ISO)

iron(0) (EXP,ISO)

iron(2+) sulfate (anhydrous) (EXP,ISO)

iron(III) citrate (ISO)

iron(III) nitrilotriacetate (ISO)

isoflurane (EXP,ISO)

isoimperatorin (EXP)

isoliquiritigenin (ISO)

isoniazide (EXP,ISO)

isophorone diisocyanate (ISO)

isoprenaline (EXP)

isorhamnetin (ISO)

Isosorbide (ISO)

isothiocyanate (ISO)

kaempferol (EXP,ISO)

kahweol (EXP,ISO)

kainic acid (ISO)

ketamine (EXP)

ketanserin (ISO)

ketoconazole (EXP,ISO)

kresoxim-methyl (ISO)

KT 5823 (ISO)

L-1,4-dithiothreitol (ISO)

L-ascorbic acid (EXP,ISO)

L-cystine (ISO)

L-glutamic acid (ISO)

L-methionine (ISO)

lactacystin (EXP,ISO)

lactulose (EXP)

lansoprazole (EXP)

lanthanum trichloride (ISO)

lapatinib (ISO)

lawsone (ISO)

lead diacetate (EXP,ISO)

lead(0) (EXP,ISO)

lead(II) chloride (EXP,ISO)

leflunomide (EXP,ISO)

lenvatinib (EXP)

Leonurine (EXP)

letrozole (EXP)

levetiracetam (EXP)

levofloxacin (EXP)

Liensinine (ISO)

linagliptin (EXP)

linalool (ISO)

linalyl acetate (ISO)

linoleic acid (ISO)

linsidomine (EXP,ISO)

lipoamide (ISO)

lipoic acid (EXP,ISO)

lipopolysaccharide (EXP,ISO)

lipoxin A4 (EXP)

liquiritigenin (EXP,ISO)

liquiritin (EXP,ISO)

liraglutide (EXP)

lithium atom (ISO)

lithium chloride (EXP,ISO)

lithium hydride (ISO)

lithocholic acid (ISO)

lixisenatide (ISO)

loganin (ISO)

loliolide (ISO)

losartan (EXP,ISO)

lovastatin (ISO)

Lucidone (ISO)

lutein (EXP,ISO)

luteolin (EXP,ISO)

Luteolin 7-methyl ether (EXP)

LY294002 (EXP,ISO)

lycopene (EXP,ISO)

Macrosphelide B (ISO)

magnesium dichloride (EXP)

malathion (ISO)

maleic acid (EXP)

malonaldehyde (EXP,ISO)

malvidin (ISO)

maneb (ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

mangiferin (EXP)

masoprocol (EXP)

mechlorethamine (ISO)

medroxyprogesterone acetate (ISO)

meglumine amidotrizoate (EXP)

MeIQx (ISO)

melatonin (EXP,ISO)

meloxicam (ISO)

menadione (ISO)

mercury atom (EXP,ISO)

mercury dibromide (ISO)

mercury dichloride (EXP,ISO)

mercury(0) (EXP,ISO)

mesalamine (EXP,ISO)

metformin (EXP,ISO)

methamphetamine (EXP,ISO)

methotrexate (EXP)

methoxyacetic acid (ISO)

methyl 3,4,5-trihydroxybenzoate (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

methylene blue (EXP,ISO)

methylglyoxal (EXP,ISO)

methylisothiazolinone (ISO)

methyllycaconitine (EXP)

methylmercury chloride (EXP,ISO)

methylparaben (ISO)

Methysticin (ISO)

metolachlor (ISO)

metrafenone (ISO)

mevalonic acid (EXP)

micafungin (EXP,ISO)

microcystin-LR (ISO)

mifepristone (EXP,ISO)

mirtazapine (EXP)

MK-2206 (EXP)

monascin (EXP,ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

Monobutylphthalate (ISO)

monocrotaline (EXP,ISO)

monocrotophos (EXP,ISO)

monosodium L-glutamate (ISO)

morin (EXP)

Morroniside (ISO)

myo-inositol hexakisphosphate (ISO)

myricetin (ISO)

N'-(2,4-dimethylphenyl)-N-methylformamidine (EXP)

N,N-diethyl-m-toluamide (EXP)

N,N-dimethylformamide (ISO)

N-(1-naphthyl)ethylenediamine (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP)

N-acetyl-1,4-benzoquinone imine (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-acetylsphingosine (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methylnicotinate (EXP,ISO)

N-Methylolacrylamide (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP,ISO)

N-phosphocreatine (EXP)

N-tosyl-L-phenylalanyl chloromethyl ketone (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

NADP zwitterion (ISO)

NADP(+) (ISO)

naphthalene (ISO)

naphthalene-1,2-diol (ISO)

naphthalene-1,5-diamine (ISO)

naringin (EXP,ISO)

nebivolol (ISO)

nefazodone (EXP)

neoastilbin (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

nicorandil (EXP)

nicotinamide (EXP,ISO)

nifedipine (ISO)

nilotinib (EXP)

nimesulide (EXP,ISO)

nitrites (EXP,ISO)

nitrofurantoin (ISO)

nitrogen mustard (ISO)

nitroprusside (EXP,ISO)

nobiletin (EXP)

Nonylphenol (EXP)

notoginsenoside R1 (EXP,ISO)

NSC 23766 (ISO)

obeticholic acid (ISO)

ochratoxin A (EXP,ISO)

octadecanoic acid (ISO)

okadaic acid (ISO)

olanzapine (ISO)

oleanolic acid (EXP,ISO)

oleic acid (ISO)

Olmesartan medoxomil (EXP)

oltipraz (EXP,ISO)

omeprazole (ISO)

Ophiopogonin D (ISO)

orlistat (EXP,ISO)

oxaliplatin (EXP,ISO)

oxazepam (ISO)

oxidopamine (EXP,ISO)

Oxyfluorfen (ISO)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

p-cresol (ISO)

paclitaxel (EXP,ISO)

paeoniflorin (ISO)

Palbinone (EXP)

pallidol (ISO)

palmatine (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

parathion-methyl (ISO)

pazopanib (ISO)

pelargonidin (ISO)

pentachloronitrobenzene (ISO)

perfluorobutanesulfonic acid (ISO)

perfluorodecanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorohexanoic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanesulfonamide (ISO)

perfluorooctanoic acid (ISO)

perfluoroundecanoic acid (ISO)

perillyl aldehyde (ISO)

permethrin (EXP)

peroxides (ISO)

pevonedistat (ISO)

phalloidin (ISO)

phenacetin (ISO)

phenanthrene (ISO)

phenethyl caffeate (EXP,ISO)

phenethyl isothiocyanate (EXP,ISO)

phenformin (ISO)

phenobarbital (EXP,ISO)

Phenyl glycidyl ether (ISO)

phenylarsine oxide (ISO)

phenylhydrazine (ISO)

phenylmercury acetate (ISO)

PhIP (ISO)

phloretin (ISO)

phlorizin (ISO)

phlorizin chalcone (ISO)

phorbol 13-acetate 12-myristate (ISO)

phorone (ISO)

phoxim (EXP)

phytoestrogen (EXP)

picolinic acid (EXP)

picoxystrobin (ISO)

pioglitazone (ISO)

piperonyl butoxide (ISO)

pipoxolan (ISO)

pirinixic acid (ISO)

platycodin D (ISO)

plumbagin (EXP,ISO)

poly(ethylene) (ISO)

poly(vinyl chloride) (ISO)

polysulfur (ISO)

porphyrins (ISO)

Potassium 2,6-dihydroxytriazinecarboxylate (ISO)

potassium dichromate (EXP,ISO)

potassium iodide (EXP)

prazosin (ISO)

prednisolone (ISO)

pregnenolone (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

probucol (EXP,ISO)

procyanidin (ISO)

procyanidin B1 (ISO)

procyanidin B2 (EXP)

prodigiosin (EXP)

progesterone (EXP)

propacetamol (ISO)

propiconazole (ISO)

prostaglandin E2 (ISO)

prostaglandin J2 (EXP)

psoralen (ISO)

pterostilbene (ISO)

puerarin (EXP,ISO)

Punicalagin (EXP)

pyocyanine (EXP,ISO)

pyrene (ISO)

pyrethrins (EXP)

pyridaben (ISO)

Pyridostigmine bromide (EXP)

pyrogallol (ISO)

pyrrolidine dithiocarbamate (EXP,ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-galactopyranoside (ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

quercetin 4'-O-beta-D-glucopyranoside (ISO)

quinolin-8-ol (ISO)

quinolinic acid (EXP)

quinoxyfen (ISO)

rac-1,2-dichloropropane (ISO)

radon atom (ISO)

radon(0) (ISO)

ranitidine (EXP)

raspberry ketone (ISO)

reactive oxygen species (EXP,ISO)

rebaudioside A (EXP)

reserpine (ISO)

resolvin D1 (EXP,ISO)

resorcinol (ISO)

resveratrol (EXP,ISO)

Rhynchophylline (ISO)

rifampicin (EXP,ISO)

rimonabant (EXP)

ritonavir (ISO)

roflumilast (EXP,ISO)

rosmarinic acid (ISO)

rosuvastatin calcium (EXP)

rotenone (EXP,ISO)

rottlerin (EXP,ISO)

royal jelly (EXP)

Ruscogenin (ISO)

Rutecarpine (ISO)

rutin (EXP,ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

S-allylcysteine (EXP,ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

sabinene (ISO)

Salinomycin (ISO)

salvianolic acid B (EXP,ISO)

saxagliptin (EXP)

SB 203580 (EXP,ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

SCH772984 (EXP)

scopolamine (EXP,ISO)

scutellarin (ISO)

sebacic acid (ISO)

selenium atom (EXP,ISO)

selenocystine (ISO)

selenomethionine (ISO)

sertraline (ISO)

sesquiterpene (ISO)

sevoflurane (EXP,ISO)

Shikonin (ISO)

silibinin (EXP)

silicon atom (EXP,ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

silver(1+) nitrate (ISO)

simvastatin (EXP,ISO)

sinapic acid (EXP)

Siomycin A (ISO)

sirolimus (EXP,ISO)

sirtinol (EXP)

SL-327 (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium cholate (ISO)

sodium dichromate (EXP,ISO)

sodium fluoride (EXP,ISO)

Sodium oleate (ISO)

sodium selenide (ISO)

sodium sulfide (anhydrous) (EXP)

solanesol (ISO)

Soman (EXP)

spathulenol (ISO)

spermidine (ISO)

spermine (ISO)

spironolactone (EXP)

staurosporine (ISO)

sterigmatocystin (EXP)

streptozocin (EXP,ISO)

succimer (ISO)

sulfaphenazole (ISO)

sulfasalazine (EXP,ISO)

sulfluramid (ISO)

sulforaphane (EXP,ISO)

sulfur atom (ISO)

sunitinib (EXP,ISO)

surfactin (ISO)

surfactin C (ISO)

T-2 toxin (EXP,ISO)

tacrolimus hydrate (ISO)

tadalafil (EXP)

tamibarotene (ISO)

tangeretin (EXP,ISO)

Tanshinone I (EXP,ISO)

taurocholic acid (ISO)

tectorigenin (ISO)

terbinafine (ISO)

terephthalic acid (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

tetramethylpyrazine (ISO)

tetrathiomolybdate(2-) (ISO)

thalidomide (ISO)

thapsigargin (ISO)

Theaflavin 3,3'-digallate (EXP,ISO)

thiamine(1+) chloride (ISO)

thiazoles (EXP)

thimerosal (ISO)

thioacetamide (EXP,ISO)

thiram (ISO)

thymoquinone (EXP,ISO)

tideglusib (ISO)

Tiron (ISO)

titanium dioxide (ISO)

tolcapone (ISO)

tolterodine tartrate (ISO)

toluquinol (ISO)

torcetrapib (ISO)

trabectedin (ISO)

trans-anethole (EXP)

trans-chalcone (ISO)

trans-piceid (ISO)

trans-rhaponticin (EXP)

triadimefon (ISO)

tributylstannane (EXP,ISO)

Tributyltin oxide (EXP,ISO)

tricalcium bis(phosphate) (ISO)

tricetin (ISO)

trichlorfon (ISO)

Trichloroacetonitrile (ISO)

trichloroethene (ISO)

trichostatin A (EXP,ISO)

triclocarban (ISO)

triclosan (ISO)

trifloxystrobin (ISO)

trifluridine (ISO)

trilobatin (EXP,ISO)

trimellitic anhydride (ISO)

trimethylarsine oxide (ISO)

trimethyltin (ISO)

triphenyl phosphate (ISO)

Triptolide (EXP,ISO)

Tris(2,3-dibromopropyl) phosphate (ISO)

troglitazone (EXP,ISO)

tropisetron (EXP)

tubastatin A (ISO)

Tungsten carbide (ISO)

tunicamycin (ISO)

tyrphostin AG 1478 (ISO)

umbelliferone (EXP,ISO)

undecan-2-one (EXP,ISO)

ursodeoxycholic acid (EXP,ISO)

usnic acid (ISO)

valproic acid (ISO)

vancomycin (EXP)

verapamil (EXP,ISO)

vincamine (ISO)

vinclozolin (EXP,ISO)

vincristine (EXP)

Vinpocetine (EXP)

vitamin D (ISO)

vitamin E (EXP,ISO)

vitexin (ISO)

vorinostat (ISO)

water (ISO)

wedelolactone (ISO)

withaferin A (ISO)

Withanone (ISO)

wortmannin (ISO)

xanthohumol (ISO)

yttrium chloride (EXP)

zearalenone (ISO)

zidovudine (EXP)

zinc atom (EXP,ISO)

zinc dichloride (EXP,ISO)

zinc oxide (EXP,ISO)

zinc protoporphyrin (EXP)

zinc pyrithione (ISO)

zinc(0) (EXP,ISO)

zingerone (EXP)

ziram (ISO)

zoledronic acid (ISO)

zoxamide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aflatoxin catabolic process (IMP)

cell redox homeostasis (IEA,IMP,ISO,ISS)

cellular response to angiotensin (IDA)

cellular response to copper ion (IEA,ISO)

cellular response to fluid shear stress (IEA,ISO,ISS)

cellular response to glucose starvation (IEA,ISO)

cellular response to hydrogen peroxide (IEA,ISO)

cellular response to hypoxia (IEA,IEP,ISO)

cellular response to laminar fluid shear stress (IEA,ISO)

cellular response to methionine (IEP)

cellular response to oxidative stress (IBA,IEA,ISO,ISS)

cellular response to tumor necrosis factor (IEA,IEP,ISO)

cellular response to xenobiotic stimulus (IEA,ISO)

endoplasmic reticulum unfolded protein response (IEA,ISO)

inflammatory response (IEA,ISO)

negative regulation of cardiac muscle cell apoptotic process (IMP)

negative regulation of cellular process (IMP)

negative regulation of cellular response to hypoxia (IMP)

negative regulation of endothelial cell apoptotic process (IEA,ISO)

negative regulation of ferroptosis (IEA,ISO,ISS)

negative regulation of hematopoietic stem cell differentiation (IEA,ISO)

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

negative regulation of vascular associated smooth muscle cell migration (IMP)

PERK-mediated unfolded protein response (IEA,ISO)

positive regulation of angiogenesis (IMP)

positive regulation of blood coagulation (IEA,ISO)

positive regulation of blood vessel endothelial cell migration (IMP)

positive regulation of D-glucose import (IEA,ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of gene expression (IEA,IMP,ISO)

positive regulation of glutathione biosynthetic process (IEA,ISO)

positive regulation of neuron projection development (IMP)

positive regulation of reactive oxygen species metabolic process (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,IMP,ISO,ISS)

proteasomal ubiquitin-independent protein catabolic process (IEA,ISO,ISS)

proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO,ISS)

protein ubiquitination (IEA,ISO,ISS)

reactive oxygen species metabolic process (IEA,ISO)

regulation of cellular response to oxidative stress (ISO)

regulation of DNA-templated transcription (IEA,ISO)

regulation of embryonic development (IEA,ISO)

regulation of gene expression (IEA)

regulation of innate immune response (IEA,ISO,ISS)

regulation of primary metabolic process (IEA)

regulation of removal of superoxide radicals (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA,IEA)

response to endoplasmic reticulum stress (IEA,ISO)

response to ischemia (IEP)

response to oxidative stress (IEA,ISO)

response to xenobiotic stimulus (IEP)

Cellular Component

centrosome (IEA,ISO)

chromatin (IEA,ISO)

ciliary basal body (IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO,TAS)

Golgi apparatus (IEA,ISO)

mediator complex (ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IDA,IEA,ISO)

plasma membrane (IEA,ISO)

protein-DNA complex (IEA,ISO)

RNA polymerase II transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO,ISS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

molecular condensate scaffold activity (IEA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

sequence-specific DNA binding (IDA,IEA,ISO)

transcription cis-regulatory region binding (IDA,IEA,ISO)

transcription coregulator binding (IPI)

ubiquitin protein ligase binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

nuclear factor, erythroid 2 like 2 signaling pathway (ISO)

oxidative stress response pathway (IDA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal incisor color (IMP)

abnormal vasodilation (IMP)

decreased vasodilation (IMP)

increased susceptibility to xenobiotic induced morbidity/mortality (IMP)

small liver (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Mast cell stabilizer modulates Sirt1/Nrf2/TNF pathway and inhibits oxidative stress, inflammation, and apoptosis in rat model of cyclophosphamide hepatotoxicity.	Abdelzaher WY, etal., Immunopharmacol Immunotoxicol. 2020 Feb 18:1-9. doi: 10.1080/08923973.2020.1727499.
2.	The molecular mechanism underlining the preventive effect of vitamin D against hepatic and renal acute toxicity through the NrF2/ BACH1/ HO-1 pathway.	Abo El-Magd NF and Eraky SM, Life Sci. 2020 Mar 1;244:117331. doi: 10.1016/j.lfs.2020.117331. Epub 2020 Jan 20.
3.	Expression of nuclear factor erythroid 2-related factor 2 (Nrf2) and peroxiredoxin 6 (Prdx6) proteins in healthy and pathologic placentas of human and rat.	Acar N, etal., Acta Histochem. 2014 Oct;116(8):1289-300. doi: 10.1016/j.acthis.2014.07.012. Epub 2014 Aug 27.
4.	Role of impaired Nrf2 activation in the pathogenesis of oxidative stress and inflammation in chronic tubulo-interstitial nephropathy.	Aminzadeh MA, etal., Nephrol Dial Transplant. 2013 Aug;28(8):2038-45. doi: 10.1093/ndt/gft022. Epub 2013 Mar 19.
5.	Alpha-lipoic acid upregulates antioxidant enzyme gene expression and enzymatic activity in diabetic rat kidneys through an O-GlcNAc-dependent mechanism.	Arambasic J, etal., Eur J Nutr. 2013 Aug;52(5):1461-73. doi: 10.1007/s00394-012-0452-z. Epub 2012 Oct 12.
6.	After cellular internalization, quercetin causes Nrf2 nuclear translocation, increases glutathione levels, and prevents neuronal death against an oxidative insult.	Arredondo F, etal., Free Radic Biol Med. 2010 Sep 1;49(5):738-47. doi: 10.1016/j.freeradbiomed.2010.05.020. Epub 2010 Jun 8.
7.	Reduction of hippocampal apoptosis by intracerebroventricular administration of extracellular signal-regulated protein kinase and/or p38 inhibitors in amyloid beta rat model of Alzheimer's disease: involvement of nuclear-related factor-2 and nuclear factor-kappaB.	Ashabi G, etal., Basic Clin Pharmacol Toxicol. 2013 Mar;112(3):145-55. doi: 10.1111/bcpt.12000. Epub 2012 Oct 5.
8.	Redox-sensitive transcription factor Nrf2 regulates vascular smooth muscle cell migration and neointimal hyperplasia.	Ashino T, etal., Arterioscler Thromb Vasc Biol. 2013 Apr;33(4):760-8. doi: 10.1161/ATVBAHA.112.300614. Epub 2013 Feb 14.
9.	Liver macrophages inhibit the endogenous antioxidant response in obesity-associated insulin resistance.	Azzimato V, etal., Sci Transl Med. 2020 Feb 26;12(532). pii: 12/532/eaaw9709. doi: 10.1126/scitranslmed.aaw9709.
10.	Prevention by sulforaphane of diabetic cardiomyopathy is associated with up-regulation of Nrf2 expression and transcription activation.	Bai Y, etal., J Mol Cell Cardiol. 2013 Apr;57:82-95. doi: 10.1016/j.yjmcc.2013.01.008. Epub 2013 Jan 23.
11.	Association between genetic polymorphisms of NRF2, KEAP1, MAFF, MAFK and anti-tuberculosis drug-induced liver injury: a nested case-control study.	Chen S, etal., Sci Rep. 2019 Oct 4;9(1):14311. doi: 10.1038/s41598-019-50706-y.
12.	Tussilagone, a major active component in Tussilago farfara, ameliorates inflammatory responses in dextran sulphate sodium-induced murine colitis.	Cheon HJ, etal., Chem Biol Interact. 2018 Oct 1;294:74-80. doi: 10.1016/j.cbi.2018.08.022. Epub 2018 Aug 22.
13.	Structural and functional characterization of Nrf2 degradation by glycogen synthase kinase 3/beta-TrCP.	Cuadrado A Free Radic Biol Med. 2015 Nov;88(Pt B):147-57. doi: 10.1016/j.freeradbiomed.2015.04.029. Epub 2015 Apr 30.
14.	A novel Danshensu derivative confers cardioprotection via PI3K/Akt and Nrf2 pathways.	Cui G, etal., Int J Cardiol. 2013 Sep 30;168(2):1349-59. doi: 10.1016/j.ijcard.2012.12.012. Epub 2013 Jan 4.
15.	Effectiveness of miltefosine treatment in targeting anti-leishmanial HO-1/Nrf-2-mediated oxidative responses in visceral leishmaniasis patients.	Das S, etal., J Antimicrob Chemother. 2013 Sep;68(9):2059-65. doi: 10.1093/jac/dkt162. Epub 2013 May 31.
16.	DL-3-n-butylphthalide extends survival by attenuating glial activation in a mouse model of amyotrophic lateral sclerosis.	Feng X, etal., Neuropharmacology. 2012 Feb;62(2):1004-10. doi: 10.1016/j.neuropharm.2011.10.009. Epub 2011 Nov 2.
17.	Thiol redox disturbances in children with severe asthma are associated with posttranslational modification of the transcription factor nuclear factor (erythroid-derived 2)-like 2.	Fitzpatrick AM, etal., J Allergy Clin Immunol. 2011 Jun;127(6):1604-11. Epub 2011 Apr 22.
18.	Activation of the nuclear factor erythroid 2-related factor 2-antioxidant response element signal in rats with diffuse axonal injury.	Gao P, etal., Neuroreport. 2019 Apr 10;30(6):389-396. doi: 10.1097/WNR.0000000000001210.
19.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
20.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
21.	Olmesartan protects against oxidative stress possibly through the Nrf2 signaling pathway and inhibits inflammation in daunorubicin-induced nephrotoxicity in rats.	Gounder VK, etal., Int Immunopharmacol. 2014 Feb;18(2):282-9. doi: 10.1016/j.intimp.2013.11.018. Epub 2013 Nov 28.
22.	Altered Nrf2/Keap1-Bach1 equilibrium in pulmonary emphysema.	Goven D, etal., Thorax. 2008 Oct;63(10):916-24. Epub 2008 Jun 17.
23.	Nrf2 Negatively Regulates Type I Interferon Responses and Increases Susceptibility to Herpes Genital Infection in Mice.	Gunderstofte C, etal., Front Immunol. 2019 Sep 6;10:2101. doi: 10.3389/fimmu.2019.02101. eCollection 2019.
24.	NRF2 SUMOylation promotes de novo serine synthesis and maintains HCC tumorigenesis.	Guo H, etal., Cancer Lett. 2019 Dec 1;466:39-48. doi: 10.1016/j.canlet.2019.09.010. Epub 2019 Sep 20.
25.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
26.	NRF2 Activates Growth Factor Genes and Downstream AKT Signaling to Induce Mouse and Human Hepatomegaly.	He F, etal., J Hepatol. 2020 Feb 12. pii: S0168-8278(20)30070-2. doi: 10.1016/j.jhep.2020.01.023.
27.	Redox regulation by nuclear factor erythroid 2-related factor 2: gatekeeping for the basal and diabetes-induced expression of thioredoxin-interacting protein.	He X and Ma Q, Mol Pharmacol. 2012 Nov;82(5):887-97. doi: 10.1124/mol.112.081133. Epub 2012 Aug 6.
28.	A novel natural Nrf2 activator with PPARgamma-agonist (monascin) attenuates the toxicity of methylglyoxal and hyperglycemia.	Hsu WH, etal., Toxicol Appl Pharmacol. 2013 Nov 1;272(3):842-51. doi: 10.1016/j.taap.2013.07.004. Epub 2013 Aug 15.
29.	Phosphorylation of Nrf2 at Ser-40 by protein kinase C regulates antioxidant response element-mediated transcription.	Huang HC, etal., J Biol Chem 2002 Nov 8;277(45):42769-74.
30.	Nrf2-dependent upregulation of antioxidative enzymes: a novel pathway for hypoxic preconditioning-mediated delayed cardioprotection.	Huang XS, etal., Mol Cell Biochem. 2014 Jan;385(1-2):33-41. doi: 10.1007/s11010-013-1812-6. Epub 2013 Sep 19.
31.	The complexity of the Nrf2 pathway: beyond the antioxidant response.	Huang Y, etal., J Nutr Biochem. 2015 Dec;26(12):1401-13. doi: 10.1016/j.jnutbio.2015.08.001. Epub 2015 Aug 8.
32.	Transcription factor Nrf2 regulates inflammation by mediating the effect of 15-deoxy-Delta(12,14)-prostaglandin j(2).	Itoh K, etal., Mol Cell Biol. 2004 Jan;24(1):36-45.
33.	Genetic ablation of Nrf2 enhances susceptibility to acute lung injury after traumatic brain injury in mice.	Jin W, etal., Exp Biol Med (Maywood). 2009 Feb;234(2):181-9.
34.	Protective effects of erythropoietin in traumatic spinal cord injury by inducing the Nrf2 signaling pathway activation.	Jin W, etal., J Trauma Acute Care Surg. 2014 May;76(5):1228-34. doi: 10.1097/TA.0000000000000211.
35.	Eriodictyol-7-O-glucoside activates Nrf2 and protects against cerebral ischemic injury.	Jing X, etal., Toxicol Appl Pharmacol. 2013 Dec 15;273(3):672-9.
36.	Luteolin confers renoprotection against ischemia-reperfusion injury via involving Nrf2 pathway and regulating miR320.	Kalbolandi SM, etal., Mol Biol Rep. 2019 Aug;46(4):4039-4047. doi: 10.1007/s11033-019-04853-0. Epub 2019 May 14.
37.	Melatonin inhibits type 1 interferon signaling of toll-like receptor 4 via heme oxygenase-1 induction in hepatic ischemia/reperfusion.	Kang JW and Lee SM, J Pineal Res. 2012 Aug;53(1):67-76. doi: 10.1111/j.1600-079X.2012.00972.x. Epub 2012 Jan 31.
38.	Phosphatidylinositol 3-kinase regulates nuclear translocation of NF-E2-related factor 2 through actin rearrangement in response to oxidative stress.	Kang KW, etal., Mol Pharmacol 2002 Nov;62(5):1001-10.
39.	Intrahippocampal injection of a lentiviral vector expressing Nrf2 improves spatial learning in a mouse model of Alzheimer's disease.	Kanninen K, etal., Proc Natl Acad Sci U S A. 2009 Sep 22;106(38):16505-10. doi: 10.1073/pnas.0908397106. Epub 2009 Sep 10.
40.	Attenuation of UVB-induced sunburn reaction and oxidative DNA damage with no alterations in UVB-induced skin carcinogenesis in Nrf2 gene-deficient mice.	Kawachi Y, etal., J Invest Dermatol. 2008 Jul;128(7):1773-9. Epub 2008 Jan 17.
41.	Glucocorticoid receptor (GR)-associated SMRT binding to C/EBPbeta TAD and Nrf2 Neh4/5: role of SMRT recruited to GR in GSTA2 gene repression.	Ki SH, etal., Mol Cell Biol. 2005 May;25(10):4150-65.
42.	Anti-fibrotic effects of L-2-oxothiazolidine-4-carboxylic acid via modulation of nuclear factor erythroid 2-related factor 2 in rats.	Kim IH, etal., BMB Rep. 2012 Jun;45(6):348-53.
43.	Sunitinib Inhibits Breast Cancer Cell Proliferation by Inducing Apoptosis, Cell-cycle Arrest and DNA Repair While Inhibiting NF-κB Signaling Pathways.	Korashy HM, etal., Anticancer Res. 2017 Sep;37(9):4899-4909. doi: 10.21873/anticanres.11899.
44.	Role of Nrf2 and p62/ZIP in the neurite outgrowth by carnosic acid in PC12h cells.	Kosaka K, etal., J Biochem. 2010 Jan;147(1):73-81. doi: 10.1093/jb/mvp149. Epub 2009 Sep 17.
45.	Knockdown of Nrf2 inhibits the angiogenesis of rat cardiac micro-vascular endothelial cells under hypoxic conditions.	Kuang L, etal., Int J Biol Sci. 2013 Jul 7;9(7):656-65. doi: 10.7150/ijbs.5887. Print 2013.
46.	Niacin and Selenium Attenuate Sepsis-Induced Lung Injury by Up-Regulating Nuclear Factor Erythroid 2-Related Factor 2 Signaling.	Kwon WY, etal., Crit Care Med. 2016 Jun;44(6):e370-82. doi: 10.1097/CCM.0000000000001422.
47.	Effects of monascin on anti-inflammation mediated by Nrf2 activation in advanced glycation end product-treated THP-1 monocytes and methylglyoxal-treated wistar rats.	Lee BH, etal., J Agric Food Chem. 2013 Feb 13;61(6):1288-98. doi: 10.1021/jf305067n. Epub 2013 Jan 31.
48.	Antiarrhythmic effect of lithium in rats after myocardial infarction by activation of Nrf2/HO-1 signaling.	Lee TM, etal., Free Radic Biol Med. 2014 Dec;77:71-81. doi: 10.1016/j.freeradbiomed.2014.08.022. Epub 2014 Sep 16.
49.	Liver injury attenuation by curcumin in a rat NASH model: an Nrf2 activation-mediated effect?	Li B, etal., Ir J Med Sci. 2016 Feb;185(1):93-100. doi: 10.1007/s11845-014-1226-9. Epub 2014 Nov 11.
50.	Age affects ERK1/2 and NRF2 signaling in the regulation of GCLC expression.	Li M, etal., J Cell Physiol. 2006 Feb;206(2):518-25.
51.	Activation of Nrf2 is required for up-regulation of the π class of glutathione S-transferase in rat primary hepatocytes with L-methionine starvation.	Lin AH, etal., J Agric Food Chem. 2012 Jul 4;60(26):6537-45. doi: 10.1021/jf301567m. Epub 2012 Jun 22.
52.	A synthetic analog of lipoxin A4 partially alleviates dexamethasone-induced fetal growth restriction in rats.	Lin F, etal., Placenta. 2013 Oct;34(10):941-8. doi: 10.1016/j.placenta.2013.07.007. Epub 2013 Aug 1.
53.	Traumatic brain injury dysregulates microRNAs to modulate cell signaling in rat hippocampus.	Liu L, etal., PLoS One. 2014 Aug 4;9(8):e103948. doi: 10.1371/journal.pone.0103948. eCollection 2014.
54.	[The effect of transcription factor KLF2 in expression of gamma-GCS depend on regulation by Nrf2 in lung of rats with chronic obstructive pulmonary disease].	Liu XY, etal., Zhongguo Ying Yong Sheng Li Xue Za Zhi. 2012 Mar;28(2):173-8.
55.	Ferulic acid prevents oxidative stress, inflammation, and liver injury via upregulation of Nrf2/HO-1 signaling in methotrexate-induced rats.	Mahmoud AM, etal., Environ Sci Pollut Res Int. 2020 Mar;27(8):7910-7921. doi: 10.1007/s11356-019-07532-6. Epub 2019 Dec 31.
56.	Decline in NRF2-regulated antioxidants in chronic obstructive pulmonary disease lungs due to loss of its positive regulator, DJ-1.	Malhotra D, etal., Am J Respir Crit Care Med. 2008 Sep 15;178(6):592-604. Epub 2008 Jun 12.
57.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
58.	Cyclo(His-Pro) up-regulates heme oxygenase 1 via activation of Nrf2-ARE signalling.	Minelli A, etal., J Neurochem. 2009 Nov;111(4):956-66. Epub 2009 Sep 7.
59.	Cryptotanshinone from the Salvia miltiorrhiza Bunge Attenuates Ethanol-Induced Liver Injury by Activation of AMPK/SIRT1 and Nrf2 Signaling Pathways.	Nagappan A, etal., Int J Mol Sci. 2019 Dec 30;21(1). pii: ijms21010265. doi: 10.3390/ijms21010265.
60.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
61.	The carboxy-terminal Neh3 domain of Nrf2 is required for transcriptional activation.	Nioi P, etal., Mol Cell Biol. 2005 Dec;25(24):10895-906.
62.	Polymorphism in the Promoter Region of NFE2L2 Gene Is a Genetic Marker of Susceptibility to Cirrhosis Associated with Alcohol Abuse.	Nunes Dos Santos K, etal., Int J Mol Sci. 2019 Jul 23;20(14). pii: ijms20143589. doi: 10.3390/ijms20143589.
63.	Nrf2 inhibits hepatic iron accumulation and counteracts oxidative stress-induced liver injury in nutritional steatohepatitis.	Okada K, etal., J Gastroenterol. 2012 Aug;47(8):924-35. Epub 2012 Feb 28.
64.	Genetic or pharmacologic amplification of nrf2 signaling inhibits acute inflammatory liver injury in mice.	Osburn WO, etal., Toxicol Sci. 2008 Jul;104(1):218-27. Epub 2008 Apr 15.
65.	Resveratrol protects diabetic kidney by attenuating hyperglycemia-mediated oxidative stress and renal inflammatory cytokines via Nrf2-Keap1 signaling.	Palsamy P and Subramanian S, Biochim Biophys Acta. 2011 Jul;1812(7):719-31. Epub 2011 Mar 23.
66.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
67.	The NRF2 knockout rat: a new animal model to study endothelial dysfunction, oxidant stress, and microvascular rarefaction.	Priestley JR, etal., Am J Physiol Heart Circ Physiol. 2016 Feb 15;310(4):H478-87. doi: 10.1152/ajpheart.00586.2015. Epub 2015 Dec 4.
68.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
69.	Curcumin nanoparticles attenuate neurochemical and neurobehavioral deficits in experimental model of Huntington's disease.	Sandhir R, etal., Neuromolecular Med. 2014 Mar;16(1):106-18. doi: 10.1007/s12017-013-8261-y. Epub 2013 Sep 6.
70.	Nuclear erythroid 2-related factor 2-antioxidative response element signaling pathway in motor cortex and spinal cord in amyotrophic lateral sclerosis.	Sarlette A, etal., J Neuropathol Exp Neurol. 2008 Nov;67(11):1055-62.
71.	Diet-relevant phytochemical intake affects the cardiac AhR and nrf2 transcriptome and reduces heart failure in hypertensive rats.	Seymour EM, etal., J Nutr Biochem. 2013 Sep;24(9):1580-6. doi: 10.1016/j.jnutbio.2013.01.008. Epub 2013 Mar 22.
72.	Antioxidant and cognitive promotion effects of anthocyanin-rich mulberry (Morus atropurpurea L.) on senescence-accelerated mice and prevention of Alzheimer's disease.	Shih PH, etal., J Nutr Biochem. 2010 Jul;21(7):598-605. doi: 10.1016/j.jnutbio.2009.03.008. Epub 2009 May 14.
73.	Olmesartan ameliorates urinary dysfunction in the spontaneously hypertensive rat via recovering bladder blood flow and decreasing oxidative stress.	Shimizu S, etal., Neurourol Urodyn. 2014 Mar;33(3):350-7. doi: 10.1002/nau.22405. Epub 2013 Jun 17.
74.	Nrf2 activators attenuate the progression of nonalcoholic steatohepatitis-related fibrosis in a dietary rat model.	Shimozono R, etal., Mol Pharmacol. 2013 Jul;84(1):62-70. doi: 10.1124/mol.112.084269. Epub 2013 Apr 16.
75.	Induction of NAD(P)H-quinone oxidoreductase 1 by antioxidants in female ACI rats is associated with decrease in oxidative DNA damage and inhibition of estrogen-induced breast cancer.	Singh B, etal., Carcinogenesis. 2012 Jan;33(1):156-63. doi: 10.1093/carcin/bgr237. Epub 2011 Nov 9.
76.	Curcumin alleviates oxidative stress, inflammation, and renal fibrosis in remnant kidney through the Nrf2-keap1 pathway.	Soetikno V, etal., Mol Nutr Food Res. 2013 Sep;57(9):1649-59. doi: 10.1002/mnfr.201200540. Epub 2012 Nov 23.
77.	Maresin 1, a Proresolving Lipid Mediator, Ameliorates Liver Ischemia-Reperfusion Injury and Stimulates Hepatocyte Proliferation in Sprague-Dawley Rats.	Soto G, etal., Int J Mol Sci. 2020 Jan 15;21(2). pii: ijms21020540. doi: 10.3390/ijms21020540.
78.	Epigallocatechin-3-gallate augments antioxidant activities and inhibits inflammation during bleomycin-induced experimental pulmonary fibrosis through Nrf2-Keap1 signaling.	Sriram N, etal., Pulm Pharmacol Ther. 2009 Jun;22(3):221-36. Epub 2008 Dec 25.
79.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
80.	Association between polymorphism of the NQO1, NOS3 and NFE2L2 genes and AMD.	Synowiec E, etal., Front Biosci (Landmark Ed). 2013 Jan 1;18:80-90.
81.	Generation of a New Model Rat: Nrf2 Knockout Rats Are Sensitive to Aflatoxin B1 Toxicity.	Taguchi K, etal., Toxicol Sci. 2016 Jul;152(1):40-52. doi: 10.1093/toxsci/kfw065. Epub 2016 Apr 12.
82.	Derivative of bardoxolone methyl, dh404, in an inverse dose-dependent manner lessens diabetes-associated atherosclerosis and improves diabetic kidney disease.	Tan SM, etal., Diabetes. 2014 Sep;63(9):3091-103. doi: 10.2337/db13-1743. Epub 2014 Apr 16.
83.	Myocardial infarction-induced microRNA-enriched exosomes contribute to cardiac Nrf2 dysregulation in chronic heart failure.	Tian C, etal., Am J Physiol Heart Circ Physiol. 2018 May 1;314(5):H928-H939. doi: 10.1152/ajpheart.00602.2017. Epub 2018 Jan 26.
84.	Antioxidant effects of diallyl trisulfide on high glucose-induced apoptosis are mediated by the PI3K/Akt-dependent activation of Nrf2 in cardiomyocytes.	Tsai CY, etal., Int J Cardiol. 2013 Sep 30;168(2):1286-97. doi: 10.1016/j.ijcard.2012.12.004. Epub 2013 Feb 27.
85.	Tomato powder impedes the development of azoxymethane-induced colorectal cancer in rats through suppression of COX-2 expression via NF-kappaB and regulating Nrf2/HO-1 pathway.	Tuzcu M, etal., Mol Nutr Food Res. 2012 Sep;56(9):1477-81. doi: 10.1002/mnfr.201200130. Epub 2012 Aug 1.
86.	Function of NADPH oxidase 1 in pulmonary arterial smooth muscle cells after monocrotaline-induced pulmonary vascular remodeling.	Veit F, etal., Antioxid Redox Signal. 2013 Dec 20;19(18):2213-31. doi: 10.1089/ars.2012.4904. Epub 2013 Jul 20.
87.	Nrf2-encoding NFE2L2 haplotypes influence disease progression but not risk in Alzheimer's disease and age-related cataract.	von Otter M, etal., Mech Ageing Dev. 2010 Feb;131(2):105-10. Epub 2010 Jan 12.
88.	LncRNA H19 inhibits ER stress induced apoptosis and improves diabetic cardiomyopathy by regulating PI3K/AKT/mTOR axis.	Wang S, etal., Aging (Albany NY). 2022 Aug 30;14(16):6809-6828. doi: 10.18632/aging.204256. Epub 2022 Aug 30.
89.	Activation of Nrf2-ARE signal pathway protects the brain from damage induced by epileptic seizure.	Wang W, etal., Brain Res. 2014 Jan 28;1544:54-61. doi: 10.1016/j.brainres.2013.12.004. Epub 2013 Dec 10.
90.	Melatonin activates the Nrf2-ARE pathway when it protects against early brain injury in a subarachnoid hemorrhage model.	Wang Z, etal., J Pineal Res. 2012 Sep;53(2):129-37. doi: 10.1111/j.1600-079X.2012.00978.x. Epub 2012 Feb 3.
91.	Lipoxin A4 ameliorates cerebral ischaemia/reperfusion injury through upregulation of nuclear factor erythroid 2-related factor 2.	Wu L, etal., Neurol Res. 2013 Nov;35(9):968-75. doi: 10.1179/1743132813Y.0000000242. Epub 2013 Jul 22.
92.	Myocardial ischemic reperfusion induces de novo Nrf2 protein translation.	Xu B, etal., Biochim Biophys Acta. 2014 Sep;1842(9):1638-47. doi: 10.1016/j.bbadis.2014.06.002. Epub 2014 Jun 8.
93.	Nadroparin sodium activates Nrf2/HO-1 pathway in acetic acid-induced colitis in rats.	Yalniz M, etal., Inflammation. 2012 Jun;35(3):1213-21. doi: 10.1007/s10753-012-9431-z.
94.	Traumatic brain injury induces the activation of the Nrf2-ARE pathway in the lung in rats.	Yan W, etal., Brain Inj. 2008 Sep;22(10):802-10.
95.	2,3,5,4'-Tetrahydroxystilbene-2-O-β-d-glucoside alleviated the acute hepatotoxicity and DNA damage in diethylnitrosamine-contaminated mice.	Yu W, etal., Life Sci. 2020 Feb 15;243:117274. doi: 10.1016/j.lfs.2020.117274. Epub 2020 Jan 9.
96.	Acceleration of the development of Alzheimer's disease in amyloid beta-infused peroxiredoxin 6 overexpression transgenic mice.	Yun HM, etal., Mol Neurobiol. 2013 Dec;48(3):941-51. doi: 10.1007/s12035-013-8479-6. Epub 2013 Jun 15.
97.	Astragaloside IV Synergizes with Ferulic Acid to Alleviate Hepatic Fibrosis in Bile Duct-Ligated Cirrhotic Rats.	Zhao XM, etal., Dig Dis Sci. 2020 Jan 3. pii: 10.1007/s10620-019-06017-3. doi: 10.1007/s10620-019-06017-3.
98.	Age-related retinopathy in NRF2-deficient mice.	Zhao Z, etal., PLoS One. 2011 Apr 29;6(4):e19456. doi: 10.1371/journal.pone.0019456.
99.	Protective effect of dioscin against thioacetamide-induced acute liver injury via FXR/AMPK signaling pathway in vivo.	Zheng L, etal., Biomed Pharmacother. 2018 Jan;97:481-488. doi: 10.1016/j.biopha.2017.10.153. Epub 2017 Nov 6.
100.	Transcription factor Nrf2-mediated antioxidant defense system in the development of diabetic retinopathy.	Zhong Q, etal., Invest Ophthalmol Vis Sci. 2013 Jun 6;54(6):3941-8. doi: 10.1167/iovs.13-11598.

Additional References at PubMed

PMID:9240432	PMID:10037736	PMID:11256947	PMID:12220541	PMID:12682069	PMID:14517290	PMID:14978030	PMID:15087497	PMID:15367669	PMID:15574414	PMID:15582588	PMID:15601839
PMID:15870071	PMID:15983046	PMID:15988009	PMID:16000310	PMID:16374848	PMID:16758951	PMID:16962933	PMID:17015834	PMID:17038627	PMID:17083329	PMID:17394461	PMID:17468336
PMID:17681938	PMID:17881530	PMID:17903176	PMID:17920186	PMID:17962605	PMID:18081878	PMID:18202225	PMID:18355458	PMID:18554677	PMID:18617559	PMID:18844975	PMID:19351736
PMID:19424503	PMID:19445907	PMID:19459163	PMID:19484125	PMID:19490425	PMID:20007347	PMID:20026152	PMID:20137388	PMID:20210857	PMID:20384467	PMID:20433640	PMID:20447451
PMID:20452972	PMID:20498371	PMID:20518088	PMID:20594978	PMID:20689134	PMID:20855618	PMID:20978266	PMID:20978343	PMID:21141598	PMID:21193948	PMID:21259333	PMID:21295052
PMID:21304811	PMID:21384399	PMID:21398409	PMID:21602469	PMID:21645446	PMID:21703357	PMID:21806470	PMID:21873460	PMID:21878664	PMID:21899994	PMID:21908547	PMID:21932039
PMID:21964506	PMID:22031657	PMID:22212472	PMID:22355716	PMID:22472608	PMID:22492997	PMID:22537865	PMID:22705828	PMID:22730684	PMID:22806321	PMID:22964297	PMID:23036869
PMID:23043106	PMID:23044235	PMID:23056222	PMID:23209658	PMID:23223967	PMID:23306837	PMID:23434824	PMID:23454680	PMID:23523995	PMID:23537652	PMID:23554160	PMID:23566817
PMID:23635713	PMID:23684718	PMID:23690560	PMID:23697596	PMID:23722164	PMID:23748533	PMID:23770986	PMID:23826208	PMID:23902943	PMID:23963778	PMID:24010821	PMID:24024172
PMID:24055888	PMID:24145448	PMID:24191235	PMID:24219386	PMID:24346829	PMID:24363993	PMID:24379627	PMID:24417315	PMID:24462598	PMID:24464634	PMID:24486487	PMID:24500986
PMID:24512358	PMID:24553817	PMID:24613837	PMID:24650792	PMID:24651515	PMID:24675471	PMID:24684352	PMID:24717297	PMID:24734887	PMID:24755082	PMID:24796753	PMID:24844779
PMID:24846271	PMID:24894866	PMID:25027760	PMID:25031697	PMID:25049078	PMID:25066072	PMID:25148934	PMID:25154877	PMID:25190803	PMID:25192797	PMID:25286336	PMID:25301875
PMID:25399330	PMID:25405338	PMID:25451293	PMID:25452227	PMID:25516494	PMID:25529839	PMID:25536319	PMID:25542256	PMID:25598205	PMID:25661380	PMID:25729983	PMID:25823828
PMID:25840997	PMID:25854558	PMID:25908459	PMID:25915512	PMID:25935309	PMID:25979858	PMID:26071777	PMID:26081287	PMID:26187356	PMID:26251179	PMID:26276082	PMID:26339354
PMID:26339453	PMID:26366057	PMID:26381691	PMID:26391895	PMID:26495793	PMID:26503970	PMID:26551455	PMID:26655811	PMID:26686249	PMID:26686388	PMID:26709780	PMID:26721360
PMID:26729624	PMID:26784831	PMID:26823945	PMID:26838164	PMID:26966893	PMID:26968794	PMID:26992040	PMID:26992899	PMID:27005782	PMID:27006750	PMID:27012032	PMID:27021411
PMID:27025721	PMID:27034737	PMID:27095375	PMID:27155659	PMID:27171848	PMID:27187458	PMID:27223823	PMID:27242267	PMID:27264719	PMID:27382429	PMID:27433291	PMID:27472294
PMID:27488664	PMID:27499091	PMID:27515502	PMID:27561292	PMID:27620662	PMID:27624937	PMID:27646262	PMID:27693383	PMID:27693416	PMID:27713551	PMID:27810365	PMID:27867096
PMID:28007572	PMID:28025064	PMID:28028237	PMID:28145852	PMID:28245986	PMID:28256256	PMID:28260081	PMID:28275300	PMID:28315454	PMID:28373766	PMID:28423592	PMID:28452959
PMID:28464602	PMID:28480587	PMID:28497199	PMID:28585088	PMID:28588747	PMID:28636290	PMID:28686978	PMID:28744340	PMID:28844677	PMID:28854440	PMID:28928429	PMID:29018201
PMID:29054681	PMID:29074371	PMID:29108993	PMID:29119264	PMID:29147465	PMID:29201913	PMID:29210072	PMID:29304479	PMID:29323739	PMID:29362432	PMID:29381299	PMID:29404371
PMID:29412163	PMID:29488137	PMID:29533123	PMID:29549163	PMID:29608952	PMID:29631592	PMID:29719281	PMID:29845199	PMID:29901143	PMID:29996121	PMID:30039750	PMID:30071128
PMID:30105650	PMID:30119254	PMID:30129387	PMID:30203709	PMID:30213522	PMID:30315936	PMID:30316779	PMID:30358118	PMID:30369549	PMID:30476502	PMID:30500779	PMID:30513452
PMID:30569102	PMID:30578379	PMID:30592315	PMID:30599315	PMID:30724852	PMID:30818054	PMID:30840298	PMID:30841430	PMID:30949917	PMID:30962285	PMID:30978363	PMID:30989783
PMID:31001960	PMID:31019649	PMID:31050655	PMID:31054488	PMID:31091144	PMID:31132190	PMID:31173878	PMID:31209719	PMID:31251976	PMID:31273531	PMID:31344704	PMID:31432116
PMID:31541683	PMID:31563143	PMID:31585542	PMID:31600004	PMID:31729530	PMID:31915512	PMID:31918011	PMID:31998437	PMID:32016469	PMID:32036037	PMID:32069075	PMID:32078205
PMID:32097614	PMID:32105681	PMID:32246423	PMID:32311231	PMID:32320433	PMID:32323734	PMID:32420373	PMID:32478470	PMID:32558131	PMID:32590729	PMID:32605461	PMID:32610255
PMID:32633393	PMID:32643505	PMID:32657424	PMID:32685505	PMID:32697403	PMID:32838965	PMID:32894623	PMID:32945417	PMID:32964992	PMID:32993187	PMID:33003644	PMID:33006714
PMID:33040818	PMID:33134382	PMID:33159299	PMID:33166863	PMID:33173963	PMID:33343809	PMID:33495841	PMID:33544450	PMID:33600051	PMID:33656642	PMID:33675841	PMID:33677805
PMID:33713981	PMID:33759307	PMID:33760331	PMID:33811899	PMID:33846774	PMID:33846798	PMID:33920318	PMID:34032369	PMID:34032546	PMID:34036379	PMID:34047419	PMID:34064070
PMID:34136984	PMID:34175407	PMID:34185425	PMID:34254317	PMID:34278476	PMID:34310894	PMID:34329667	PMID:34399353	PMID:34440619	PMID:34495404	PMID:34673854	PMID:34699317
PMID:34699582	PMID:34881386	PMID:34914307	PMID:34918390	PMID:35026282	PMID:35038776	PMID:35075205	PMID:35109747	PMID:35159376	PMID:35360547	PMID:35498128	PMID:35596948
PMID:35726572	PMID:35843349	PMID:36040608	PMID:36091668	PMID:36359788	PMID:36736873	PMID:36807051	PMID:36819786	PMID:36856923	PMID:36916102	PMID:36998992	PMID:37122072
PMID:37146710	PMID:37169128	PMID:37169561	PMID:37183461	PMID:37579617	PMID:37603610	PMID:37674036	PMID:37818693	PMID:37822721	PMID:37992540	PMID:38097051	PMID:38158661
PMID:38215951	PMID:38260951	PMID:38308640	PMID:38311279	PMID:38344831	PMID:38350966	PMID:38436106	PMID:38822202	PMID:38845495	PMID:38943181	PMID:38944076	PMID:39084457
PMID:39097921	PMID:39264079

Genomics

Comparative Map Data

Nfe2l2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,001,529 - 81,031,165 (-)	NCBI		GRCr8
mRatBN7.2	3	60,594,239 - 60,621,712 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,594,242 - 60,621,737 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	63,968,507 - 63,995,961 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,552,163 - 72,579,616 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,318,419 - 70,345,871 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,497,568 - 62,525,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,497,571 - 62,524,996 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,041,641 - 69,069,190 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	58,366,693 - 58,394,116 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	58,263,064 - 58,290,488 (-)	NCBI
Celera	3	60,095,041 - 60,122,464 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

NFE2L2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	177,230,303 - 177,264,727 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	177,218,667 - 177,392,756 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	178,095,031 - 178,129,455 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	177,803,282 - 177,837,663 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	177,920,542 - 177,954,924	NCBI
Celera	2	171,697,459 - 171,732,295 (-)	NCBI		Celera
Cytogenetic Map	2	q31.2	NCBI
HuRef	2	169,966,324 - 170,001,125 (-)	NCBI		HuRef
CHM1_1	2	178,100,863 - 178,135,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	177,712,539 - 177,746,971 (-)	NCBI		T2T-CHM13v2.0

Nfe2l2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	75,505,860 - 75,535,007 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	75,505,857 - 75,534,985 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	75,675,513 - 75,704,663 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	75,675,513 - 75,704,641 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	75,513,576 - 75,542,698 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	75,476,358 - 75,505,480 (-)	NCBI		MGSCv36	mm8
Celera	2	77,336,615 - 77,365,680 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.75	NCBI

Nfe2l2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	19,532,103 - 19,535,944 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	19,510,122 - 19,536,428 (+)	NCBI	ChiLan1.0	ChiLan1.0

NFE2L2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	79,896,932 - 80,058,685 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	79,911,905 - 80,073,664 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	64,509,446 - 64,544,600 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	182,214,116 - 182,248,282 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	182,214,116 - 182,248,085 (-)	Ensembl	panpan1.1		panPan2

NFE2L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	20,989,205 - 21,087,044 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	20,989,360 - 21,012,524 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	21,008,912 - 21,151,059 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	21,133,291 - 21,275,953 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	21,133,296 - 21,276,012 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	21,203,925 - 21,237,606 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	21,205,089 - 21,302,516 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	21,320,865 - 21,418,596 (-)	NCBI		UU_Cfam_GSD_1.0

Nfe2l2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	138,036,230 - 138,177,608 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	6,590,630 - 6,620,262 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	6,589,967 - 6,621,171 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NFE2L2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	82,973,656 - 83,146,183 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	82,967,485 - 83,146,185 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	92,433,294 - 92,469,024 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NFE2L2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	62,789,647 - 62,825,651 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	62,790,124 - 62,825,339 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	136,640,202 - 136,820,663 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nfe2l2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	14,355,791 - 14,381,251 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	14,355,330 - 14,381,353 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nfe2l2
96 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	217
Count of miRNA genes:	158
Interacting mature miRNAs:	173
Transcripts:	ENSRNOT00000002114
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Markers in Region

RH130653

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	60,597,065 - 60,597,248 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	62,500,392 - 62,500,574	NCBI	Rnor6.0
Rnor_5.0	3	69,044,468 - 69,044,650	UniSTS	Rnor5.0
RGSC_v3.4	3	58,369,514 - 58,369,696	UniSTS	RGSC3.4
Celera	3	60,097,862 - 60,098,044	UniSTS
Cytogenetic Map	3	q23	UniSTS

BI284301

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	60,594,712 - 60,594,869 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	62,498,039 - 62,498,195	NCBI	Rnor6.0
Rnor_5.0	3	69,042,115 - 69,042,271	UniSTS	Rnor5.0
RGSC_v3.4	3	58,367,161 - 58,367,317	UniSTS	RGSC3.4
Celera	3	60,095,509 - 60,095,665	UniSTS
Cytogenetic Map	3	q23	UniSTS

RH135926

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	60,594,910 - 60,595,115 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	62,498,237 - 62,498,441	NCBI	Rnor6.0
Rnor_5.0	3	69,042,313 - 69,042,517	UniSTS	Rnor5.0
RGSC_v3.4	3	58,367,359 - 58,367,563	UniSTS	RGSC3.4
Celera	3	60,095,707 - 60,095,911	UniSTS
Cytogenetic Map	3	q23	UniSTS

Nfe2l2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	60,595,122 - 60,596,303 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	62,498,449 - 62,499,629	NCBI	Rnor6.0
Rnor_5.0	3	69,042,525 - 69,043,705	UniSTS	Rnor5.0
RGSC_v3.4	3	58,367,571 - 58,368,751	UniSTS	RGSC3.4
Celera	3	60,095,919 - 60,097,099	UniSTS
Cytogenetic Map	3	q23	UniSTS

Genetic Models

This gene Nfe2l2 is modified in the following models/strains:

SD-Nfe2l2^em1Mcwi SD-Nfe2l2^em1Mcwi-/- F344-Nfe2l2^em2Kyo F344-Nfe2l2^em1Kyo

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001399173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_031789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF037350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002114 ⟹ ENSRNOP00000002114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	60,594,242 - 60,621,737 (-)	Ensembl
Rnor_6.0 Ensembl	3	62,497,571 - 62,524,996 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104413 ⟹ ENSRNOP00000087804

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	60,594,242 - 60,605,874 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110389 ⟹ ENSRNOP00000097870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	60,594,242 - 60,598,646 (-)	Ensembl

RefSeq Acc Id:

NM_001399173 ⟹ NP_001386102

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,001,529 - 81,028,999 (-)	NCBI
mRatBN7.2	3	60,594,239 - 60,621,712 (-)	NCBI

RefSeq Acc Id:

NM_031789 ⟹ NP_113977

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,001,529 - 81,028,999 (-)	NCBI
mRatBN7.2	3	60,594,239 - 60,621,712 (-)	NCBI
Rnor_6.0	3	62,497,571 - 62,524,994 (-)	NCBI
Rnor_5.0	3	69,041,641 - 69,069,190 (-)	NCBI
RGSC_v3.4	3	58,366,693 - 58,394,116 (-)	RGD
Celera	3	60,095,041 - 60,122,464 (-)	RGD

Sequence:

show sequence

CGCCGCCTCACCTCTGCTGCCAGTAGCCTCGCCGTCGGGGAGCCCTAGCGCAGCGTCCGCCCTC
AGCATGATGGACTTGGAATTGCCACCGCCAGGACTACAGTCCCAGCAGGACATGGATTTGATTG
ACATCCTTTGGAGGCAAGACATAGATCTTGGGGTAAGTCGAGAAGTGTTTGACTTTAGTCAGCG
ACAGAAGGATTATGAGCTGGAAAAACAGAAAAAACTCGAAAAGGAGAGACAAGAGCAACTCCAG
AAGGAACAGGAGAAGGCCTTTTTCGCTCAGTTACAACTGGATGAAGAGACCGGAGAATTCCTCC
CAATTCAGCCAGCCCAGCACATCCAGACAGACACCAGTGGATCTGTCAGCTACTCCCAGGTTGC
CCACATTCCCAAACAAGATGCCTTGTACTTTGAAGACTGTATGCAGCTTTTGGCAGAGACATTC
CCATTTGTAGATGACCATGAGTCGCTTGCCCTGGATATTCCCAGCCACGTTGAGAGCTCAGTCT
TCACCACCCCTGATCAGGCTCAGTCACTCGATAGCTCTCTGGAGACGGCCATGACTGATTTAAG
CAGCATACAGCAGGACATGGAGCAAGTTTGGCAGGAGCTATTTTCCATTCCCGAGTTACAGTGT
CTTAATACGGAAAACAAGCAGCAGGCTGAGACTACCACTGTCCCCAGCCCAGAGGCCACACTGA
CAGAGATGGACAGCAATTACCATTTTTACTCATCGATCCCCTCACTGGAAAAAGAAGTGGACAG
CTGTAGTCCACATTTCCTTCATGGTTTTGAGGATTCTTTTAGCAGCATCCTCTCCACGGATGAT
GCCAGCCAGCTGAACTCCTTAGACTCAAATCCCACCTTGAACACAGATTTCGGTGATGAATTTT
ACTCTGCTTTCCTAGCAGAGCCCAGTGGCGGTGGCAGCATGCCTTCCTCTGCTGCCATTAGTCA
GTCGCTCTCTGAACTTCTGGGCGGGCCCATTGAGGGCTGTGATCTGTCCCTGTGTAAAGCTTTC
AACCAGAAGCACACTGAAGGCACGGTGGAGTTCAATGACTCTGACTCCGGCATTTCACTGAACA
CAAGTCCCAGCCGAGCATCCCCAGAGCACTCTGTGGAGTCTTCCATTTACGGAGACCCACCGCC
TGGGTTCAGTGACTCGGAAATGGAAGAGCTAGACAGTGCCCCTGGAAGTGTCAAACAGAATGGA
CCTAAAGCACAGCCAACACATTCTTCTGGGGATACAGTACAGCCTCTGTCGCCAGCTCAAGGGC
ACAGTGCTGCTGTGCACGAATCCCAGTGTGAAAATACAACAAAAAAAGAAGTACCTGTGAGTCC
TGGTCATCAAAAAGTCCCATTCACAAAAGACAAACATTCAAGCCGATTAGAGGCTCATCTCACA
AGAGATGAGCTTAGGGCAAAAGCTCTCCATATTCCATTCCCTGTTGAAAAAATCATTAATCTCC
CTGTTGATGACTTCAATGAAATGATGTCCAAGGAGCAATTCAACGAAGCTCAGCTTGCATTAAT
TCGAGATATACGCAGGAGAGGGAAGAATAAAGTTGCCGCTCAGAACTGTAGGAAAAGGAAGCTG
GAAAACATTGTAGAGCTGGAGCAAGACTTGGGCCACTTAAAAGACGAGAGAGAAAAACTACTCA
GAGAAAAGGGAGAAAACGACAGAAACCTCCATCTTCTGAAAAGAAAACTCAGCACTTTGTATCT
GGAAGTCTTCAGCATGTTACGTGATGAGGATGGGAAACCTTACTCTCCCAGTGAGTACTCTCTG
CAGCAGACCAGAGATGGCAACGTGTTCCTTGTTCCCAAGAGCAAGAAGCCAGATACAAAGAAAA
ACTAGGTTCGGGAGGATGGAGCCTTTTCTGAGCTAGTGTTTGTTTTGTACGGCTAAAACTTCCT
ACTGTGATGTGAAATGCAGAAACACTTTATAAGTAACTATGCAGAATTATAGCCAAAGCTAGTG
TAGAAATAATATGAAACTTTACAAAGCATTAAAGTCTCAATGTTGAATCAGTTTCATTTTAACT
CTCAAGTTAATTTCTTGGGCACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAGAACT
TATTTATACTGTTCTCATTTGTTACAGTCATAGACTTATATGACATCTGGCTAAAAGCAAACTA
TTGAAAACTAACCAAACCACTATACTTTTTTATATACTGTATGAACAAGAAATGACATTTTTAT
ATTAAATTGTTTAGCTCTGATAAAAATTAAAAGGAGCTAGCACTAATAAAGGAATATCATGACT
T

hide sequence

RefSeq Acc Id:

XM_006234398 ⟹ XP_006234460

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,001,532 - 81,028,809 (-)	NCBI
mRatBN7.2	3	60,594,239 - 60,621,528 (-)	NCBI
Rnor_6.0	3	62,497,568 - 62,524,157 (-)	NCBI
Rnor_5.0	3	69,041,641 - 69,069,190 (-)	NCBI

Sequence:

show sequence

GTCGGCCCCATGCGGGGCTGTGTGTTCTGAGTATCGTGACTCGCGGGGCCCCACGTTGTGTGCG
TGGCTGTGGCCTCCGGGTGGCTTACAACGGACATGGATTTGATTGACATCCTTTGGAGGCAAGA
CATAGATCTTGGGGTAAGTCGAGAAGTGTTTGACTTTAGTCAGCGACAGAAGGATTATGAGCTG
GAAAAACAGAAAAAACTCGAAAAGGAGAGACAAGAGCAACTCCAGAAGGAACAGGAGAAGGCCT
TTTTCGCTCAGTTACAACTGGATGAAGAGACCGGAGAATTCCTCCCAATTCAGCCAGCCCAGCA
CATCCAGACAGACACCAGTGGATCTGTCAGCTACTCCCAGGTTGCCCACATTCCCAAACAAGAT
GCCTTGTACTTTGAAGACTGTATGCAGCTTTTGGCAGAGACATTCCCATTTGTAGATGACCATG
AGGTTTCTTCACCTACATTTCAGTCGCTTGCCCTGGATATTCCCAGCCACGTTGAGAGCTCAGT
CTTCACCACCCCTGATCAGGCTCAGTCACTCGATAGCTCTCTGGAGACGGCCATGACTGATTTA
AGCAGCATACAGCAGGACATGGAGCAAGTTTGGCAGGAGCTATTTTCCATTCCCGAGTTACAGT
GTCTTAATACGGAAAACAAGCAGCAGGCTGAGACTACCACTGTCCCCAGCCCAGAGGCCACACT
GACAGAGATGGACAGCAATTACCATTTTTACTCATCGATCCCCTCACTGGAAAAAGAAGTGGAC
AGCTGTAGTCCACATTTCCTTCATGGTTTTGAGGATTCTTTTAGTAGCATCCTCTCCACGGATG
ATGCCAGCCAGCTGAACTCCTTAGACTCAAATCCCACCTTGAACACAGATTTCGGTGATGAATT
TTACTCTGCTTTCCTAGCAGAGCCCAGTGGCGGTGGCAGCATGCCTTCCTCTGCTGCCATTAGT
CAGTCGCTCTCTGAACTTCTGGGCGGGCCCATTGAGGGCTGTGATCTGTCCCTGTGTAAAGCTT
TCAACCAGAAGCACACTGAAGGCACGGTGGAGTTCAATGACTCTGACTCCGGCATTTCGCTGAA
CACAAGTCCCAGCCGAGCATCCCCAGAGCACTCTGTGGAGTCTTCCATTTACGGAGACCCACCG
CCTGGGTTCAGTGACTCGGAAATGGAAGAGCTAGACAGTGCCCCTGGAAGTGTCAAACAGAATG
GACCTAAAGCACAGCCAACACATTCTTCTGGGGATACAGTACAGCCTCTGTCGCCAGCTCAAGG
GCACAGTGCTGCTGTGCACGAATCCCAGTGTGAAAATACAACAAAAAAAGAAGTACCTGTGAGT
CCTGGTCATCAAAAAGTCCCATTCACAAAAGACAAACATTCAAGCCGATTAGAGGCTCATCTCA
CAAGAGATGAGCTTAGGGCAAAAGCTCTCCATATTCCATTCCCTGTTGAAAAAATCATTAATCT
CCCTGTTGATGACTTCAATGAAATGATGTCCAAGGAGCAATTCAACGAAGCTCAGCTTGCATTA
ATTCGAGATATACGCAGGAGAGGGAAGAATAAAGTTGCCGCTCAGAACTGTAGGAAAAGGAAGC
TGGAAAACATTGTAGAGCTGGAGCAAGACTTGGGCCACTTAAAAGACGAGAGAGAAAAACTACT
CAGAGAAAAGGGAGAAAACGACAGAAACCTCCATCTTCTGAAAAGAAAACTCAGCACTTTGTAT
CTGGAAGTCTTCAGCATGTTACGTGATGAGGATGGGAAACCTTACTCTCCCAGTGAGTACTCTC
TGCAGCAGACCAGAGATGGCAACGTGTTCCTTGTTCCCAAGAGCAAGAAGCCAGATACAAAGAA
AAACTAGGTTCGGGAGGATGGAGCCTTTTCTGAGCTAGTGTTTGTTTTGTACGGCTAAAACTTC
CTACTGTGATGTGAAATGCAGAAACACTTTATAAGTAACTATGCAGAATTATAGCCAAAGCTAG
TGTAGAAATAATATGAAACTTTACAAAGCATTAAAGTCTCAATGTTGAATCAGTTTCATTTTAA
CTCTCAAGTTAATTTCTTGGGCACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAGAA
CTTATTTATACTGTTCTCATTTGTTACAGTCATAGACTTATATGACATCTGGCTAAAAGCAAAC
TATTGAAAACTAACCAAACCACTATACTTTTTTATATACTGTATGAACAAGAAATGACATTTTT
ATATTAAATTGTTTAGCTCTGATAAAAATTAAAAGGAGCTAGCACTAATAAAGGAATATCATGA
CTTAAA

hide sequence

RefSeq Acc Id:

XM_063284651 ⟹ XP_063140721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,001,532 - 81,031,165 (-)	NCBI

RefSeq Acc Id:

XM_063284652 ⟹ XP_063140722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,001,532 - 81,031,165 (-)	NCBI

RefSeq Acc Id:

XM_063284653 ⟹ XP_063140723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,001,532 - 81,028,813 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001386102	(Get FASTA)	NCBI Sequence Viewer
	NP_113977	(Get FASTA)	NCBI Sequence Viewer
	XP_006234460	(Get FASTA)	NCBI Sequence Viewer
	XP_063140721	(Get FASTA)	NCBI Sequence Viewer
	XP_063140722	(Get FASTA)	NCBI Sequence Viewer
	XP_063140723	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB92256	(Get FASTA)	NCBI Sequence Viewer
	AAH61724	(Get FASTA)	NCBI Sequence Viewer
	EDL79208	(Get FASTA)	NCBI Sequence Viewer
	EDL79209	(Get FASTA)	NCBI Sequence Viewer
	EDL79210	(Get FASTA)	NCBI Sequence Viewer
	EDL79211	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002114
	ENSRNOP00000002114.6
	ENSRNOP00000087804.1
	ENSRNOP00000097870.1
GenBank Protein	O54968	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113977 ⟸ NM_031789
- Peptide Label:	isoform 2
- UniProtKB:	A6HMF7 (UniProtKB/TrEMBL), A0A8I6AV20 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQK EQEKAFFAQLQLDEETGEFLPIQPAQHIQTDTSGSVSYSQVAHIPKQDALYFEDCMQLLAETFP FVDDHESLALDIPSHVESSVFTTPDQAQSLDSSLETAMTDLSSIQQDMEQVWQELFSIPELQCL NTENKQQAETTTVPSPEATLTEMDSNYHFYSSIPSLEKEVDSCSPHFLHGFEDSFSSILSTDDA SQLNSLDSNPTLNTDFGDEFYSAFLAEPSGGGSMPSSAAISQSLSELLGGPIEGCDLSLCKAFN QKHTEGTVEFNDSDSGISLNTSPSRASPEHSVESSIYGDPPPGFSDSEMEELDSAPGSVKQNGP KAQPTHSSGDTVQPLSPAQGHSAAVHESQCENTTKKEVPVSPGHQKVPFTKDKHSSRLEAHLTR DELRAKALHIPFPVEKIINLPVDDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLE NIVELEQDLGHLKDEREKLLREKGENDRNLHLLKRKLSTLYLEVFSMLRDEDGKPYSPSEYSLQ QTRDGNVFLVPKSKKPDTKKN hide sequence

RefSeq Acc Id:	XP_006234460 ⟸ XM_006234398
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6A7Z8 (UniProtKB/TrEMBL), A6HMG0 (UniProtKB/TrEMBL), A0A8I6AV20 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEET GEFLPIQPAQHIQTDTSGSVSYSQVAHIPKQDALYFEDCMQLLAETFPFVDDHEVSSPTFQSLA LDIPSHVESSVFTTPDQAQSLDSSLETAMTDLSSIQQDMEQVWQELFSIPELQCLNTENKQQAE TTTVPSPEATLTEMDSNYHFYSSIPSLEKEVDSCSPHFLHGFEDSFSSILSTDDASQLNSLDSN PTLNTDFGDEFYSAFLAEPSGGGSMPSSAAISQSLSELLGGPIEGCDLSLCKAFNQKHTEGTVE FNDSDSGISLNTSPSRASPEHSVESSIYGDPPPGFSDSEMEELDSAPGSVKQNGPKAQPTHSSG DTVQPLSPAQGHSAAVHESQCENTTKKEVPVSPGHQKVPFTKDKHSSRLEAHLTRDELRAKALH IPFPVEKIINLPVDDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDL GHLKDEREKLLREKGENDRNLHLLKRKLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFL VPKSKKPDTKKN hide sequence

Ensembl Acc Id:

ENSRNOP00000002114 ⟸ ENSRNOT00000002114

Ensembl Acc Id:

ENSRNOP00000087804 ⟸ ENSRNOT00000104413

Ensembl Acc Id:

ENSRNOP00000097870 ⟸ ENSRNOT00000110389

RefSeq Acc Id:	NP_001386102 ⟸ NM_001399173
- Peptide Label:	isoform 1
- UniProtKB:	O54968 (UniProtKB/Swiss-Prot), Q6P7C8 (UniProtKB/Swiss-Prot), A0A8I6AV20 (UniProtKB/TrEMBL), A6HMF8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140722 ⟸ XM_063284652
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AV20 (UniProtKB/TrEMBL), A6HMF7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140721 ⟸ XM_063284651
- Peptide Label:	isoform X1
- UniProtKB:	Q6P7C8 (UniProtKB/Swiss-Prot), O54968 (UniProtKB/Swiss-Prot), A0A8I6AV20 (UniProtKB/TrEMBL), A6HMF8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140723 ⟸ XM_063284653
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AV20 (UniProtKB/TrEMBL), A6HMF9 (UniProtKB/TrEMBL)

Protein Domains

bZIP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O54968-F1-model_v2	AlphaFold	O54968	1-604	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692153

Promoter ID:

EPDNEW_R2678

Type:

initiation region

Name:

Nfe2l2_1

Description:

nuclear factor, erythroid 2-like 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	62,525,015 - 62,525,075	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620360	AgrOrtholog
BioCyc Gene	G2FUF-49302	BioCyc
Ensembl Genes	ENSRNOG00000001548	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002114	ENTREZGENE
	ENSRNOT00000002114.7	UniProtKB/Swiss-Prot
	ENSRNOT00000104413.1	UniProtKB/TrEMBL
	ENSRNOT00000110389.1	UniProtKB/TrEMBL
Gene3D-CATH	Transcription factor, Skn-1-like, DNA-binding domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598313	IMAGE-MGC_LOAD
InterPro	bZIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	bZIP_Maf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	bZIP_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NFE2-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83619	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72386	IMAGE-MGC_LOAD
NCBI Gene	83619	ENTREZGENE
PANTHER	NUCLEAR FACTOR ERYTHROID 2-RELATED FACTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24411:SF3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	bZIP_Maf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nfe2l2	PhenoGen
PROSITE	BZIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BZIP_BASIC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001548	RatGTEx
SMART	BRLZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47454	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57959	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A7Z8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AV20	ENTREZGENE, UniProtKB/TrEMBL
	A6HMF7	ENTREZGENE, UniProtKB/TrEMBL
	A6HMF8	ENTREZGENE, UniProtKB/TrEMBL
	A6HMF9	ENTREZGENE, UniProtKB/TrEMBL
	A6HMG0	ENTREZGENE, UniProtKB/TrEMBL
	NF2L2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6P7C8	ENTREZGENE
UniProt Secondary	Q6P7C8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-22	Nfe2l2	nuclear factor, erythroid 2-like 2	Nfe2l2	nuclear factor, erythroid derived 2, like 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Nfe2l2	nuclear factor, erythroid derived 2, like 2		NF-E2-related factor 2	Name updated	1299863	APPROVED
2002-08-07	Nfe2l2	NF-E2-related factor 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	phosphorylated on Ser-40 by protein kinase C resulting in translocation to nucleus	729231
gene_regulation	translocation to the nucleus is controled by PI3-kinase signaling pathway which regulates rearrangement of actin microfilaments in response to oxidative stress	727460

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype