Ereg (epiregulin) - Rat Genome Database

Name: Ereg
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ereg (epiregulin) Rattus norvegicus

Analyze

Symbol:

Ereg

Name:

epiregulin

RGD ID:

620299

Description:

Enables growth factor activity. Involved in several processes, including female gamete generation; luteinizing hormone signaling pathway; and positive regulation of mitotic nuclear division. Located in extracellular space. Human ortholog(s) of this gene implicated in extrapulmonary tuberculosis; pulmonary tuberculosis; and tuberculosis. Orthologous to human EREG (epiregulin); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,2,4-trimethylbenzene; 1,2-dimethylhydrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

epiregulin precursor; proepiregulin

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EREG (epiregulin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ereg (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ereg (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EREG (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EREG (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ereg (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EREG (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EREG (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ereg (epiregulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	EREG (epiregulin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ereg (epiregulin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	igeg-1	Alliance	DIOPT (PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ereg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	17,027,287 - 17,041,062 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	17,027,287 - 17,041,062 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	17,029,016 - 17,042,901 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	18,347,942 - 18,361,825 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	17,040,063 - 17,053,944 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	18,577,620 - 18,591,395 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	18,576,355 - 18,591,394 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	18,486,956 - 18,500,731 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	18,521,069 - 18,534,844 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	18,521,068 - 18,534,844 (-)	NCBI
Celera	14	16,405,096 - 16,418,803 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cholesteatoma (ISO)

erythropoietic protoporphyria (ISO)

Experimental Colitis (ISO)

extrapulmonary tuberculosis (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

Ovarian Neoplasms (ISO)

pulmonary tuberculosis (ISO)

tuberculosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (EXP,ISO)

1,8-Dinitropyrene (ISO)

1-nitropyrene (ISO)

15-acetyldeoxynivalenol (ISO)

17beta-estradiol (EXP,ISO)

2,3,4,7,8-Pentachlorodibenzofuran (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (ISO)

3-methylcholanthrene (ISO)

3-Nitrobenzanthrone (ISO)

4-aminosalicylic acid (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

AL 8810 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

alpidem (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amodiaquine (ISO)

amphotericin B (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP,ISO)

batimastat (ISO)

benzo[a]pyrene (ISO)

bifenthrin (EXP)

biperiden (ISO)

bisphenol A (EXP,ISO)

bromfenac (ISO)

butanal (ISO)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

Chorionic gonadotropin (ISO)

cisplatin (ISO)

clavulanic acid (ISO)

cobalt atom (ISO)

colforsin daropate hydrochloride (ISO)

crocidolite asbestos (ISO)

cumene (ISO)

cycloheximide (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diallyl trisulfide (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

Didecyldimethylammonium (ISO)

dimethylarsinic acid (ISO)

dioxygen (EXP,ISO)

diphenhydramine (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

entacapone (ISO)

esmolol (ISO)

etodolac (ISO)

etoposide (ISO)

ferroheme b (ISO)

Fexofenadine hydrochloride (ISO)

flavonoids (EXP)

fludrocortisone (ISO)

fluoranthene (ISO)

flutamide (EXP,ISO)

fulvestrant (EXP)

genistein (EXP)

gentamycin (EXP)

griseofulvin (ISO)

heme b (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

Iproniazid (ISO)

irinotecan (ISO)

isoprenaline (ISO)

ketoconazole (ISO)

ketorolac tromethamine (ISO)

lipopolysaccharide (ISO)

lumiracoxib (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mebendazole (ISO)

meloxicam (ISO)

metam (ISO)

methimazole (EXP)

methotrexate (ISO)

methylarsonic acid (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

metronidazole (ISO)

minoxidil (ISO)

mirex (EXP)

monobenzyl phthalate (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

N-Nitrosopyrrolidine (ISO)

naphthalenes (EXP)

nefazodone (ISO)

nevirapine (ISO)

nickel atom (ISO)

nimesulide (ISO)

Nonylphenol (EXP)

O-methyleugenol (ISO)

ochratoxin A (ISO)

ozone (EXP,ISO)

paracetamol (ISO)

paraquat (EXP)

penbutolol (ISO)

pentanal (ISO)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

Phenoxybenzamine (ISO)

phentolamine (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosgene (ISO)

pioglitazone (ISO)

pirprofen (ISO)

potassium bromate (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

primaquine (ISO)

procyclidine (ISO)

propanal (ISO)

prostaglandin E2 (ISO)

prostaglandin F2alpha (ISO)

protein kinase inhibitor (ISO)

protoporphyrins (ISO)

protriptyline (ISO)

quercetin (ISO)

retinyl palmitate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

T-2 toxin (ISO)

tetrachloromethane (ISO)

tienilic acid (ISO)

titanium dioxide (EXP)

tolcapone (ISO)

trazodone (ISO)

triadimefon (ISO)

trichloroethene (EXP)

Trihexyphenidyl (ISO)

triphenyl phosphate (ISO)

triprolidine (ISO)

triptonide (ISO)

troglitazone (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

vinyl carbamate (ISO)

zafirlukast (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IEA)

cell-cell signaling (ISO,ISS)

cytokine-mediated signaling pathway (ISO,ISS)

epidermal growth factor receptor signaling pathway (IBA,IDA,ISO,ISS)

ERBB2-EGFR signaling pathway (ISO)

ERBB2-ERBB4 signaling pathway (ISO)

ERBB4-ERBB4 signaling pathway (ISO)

female meiotic nuclear division (IDA)

keratinocyte proliferation (ISO,ISS)

luteinizing hormone signaling pathway (IDA)

mRNA transcription (ISO,ISS)

negative regulation of cell population proliferation (ISO,ISS)

negative regulation of DNA-templated transcription (ISO,ISS)

negative regulation of smooth muscle cell differentiation (ISO,ISS)

oocyte maturation (IDA)

ovarian cumulus expansion (IDA)

ovulation (IDA)

positive regulation of angiogenesis (TAS)

positive regulation of cell division (IEA)

positive regulation of cell population proliferation (IBA,IDA,ISO,ISS)

positive regulation of cytokine production (ISO,ISS)

positive regulation of DNA replication (IDA,ISO,ISS)

positive regulation of fibroblast proliferation (ISO,ISS)

positive regulation of innate immune response (ISO,ISS)

positive regulation of interleukin-6 production (ISO,ISS)

positive regulation of mitotic nuclear division (IBA,IDA,ISO,ISS)

positive regulation of phosphorylation (ISO,ISS)

positive regulation of smooth muscle cell proliferation (IDA,IMP)

primary follicle stage (IDA)

response to peptide hormone (IEP)

Cellular Component

extracellular space (IBA,IDA,ISO,ISS)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

epidermal growth factor receptor binding (IBA,ISO,ISS)

growth factor activity (IBA,IDA,TAS)

protein binding (ISO)

receptor ligand activity (ISO)

transmembrane receptor protein tyrosine kinase activator activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

epidermal growth factor/neuregulin signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Epidermal growth factor family members: endogenous mediators of the ovulatory response.	Ashkenazi H, etal., Endocrinology. 2005 Jan;146(1):77-84. Epub 2004 Sep 30.
2.	Polymorphism in the EREG gene confers susceptibility to tuberculosis.	Cao W, etal., BMC Med Genet. 2019 Jan 11;20(1):7. doi: 10.1186/s12881-018-0729-z.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Toll-like receptor 4 differentially regulates epidermal growth factor-related growth factors in response to intestinal mucosal injury.	Hsu D, etal., Lab Invest. 2010 Sep;90(9):1295-305. doi: 10.1038/labinvest.2010.100. Epub 2010 May 24.
6.	Mechanism of growth promoting activity of epiregulin in primary cultures of rat hepatocytes.	Komurasaki T, etal., Growth Factors 2002 Jun;20(2):61-9.
7.	Factor Xa induces mitogenesis of vascular smooth muscle cells via autocrine production of epiregulin.	Koo BH and Kim DS, J Biol Chem. 2003 Dec 26;278(52):52578-86. Epub 2003 Oct 21.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Transcriptional regulation of the epiregulin gene in the rat ovary.	Sekiguchi T, etal., Endocrinology 2002 Dec;143(12):4718-29.
16.	Autocrine, paracrine and juxtacrine signaling by EGFR ligands.	Singh AB and Harris RC, Cell Signal. 2005 Oct;17(10):1183-93.
17.	Epiregulin is a potent vascular smooth muscle cell-derived mitogen induced by angiotensin II, endothelin-1, and thrombin.	Taylor DS, etal., Proc Natl Acad Sci U S A 1999 Feb 16;96(4):1633-8.
18.	Expression of the epidermal growth factor system in human middle ear cholesteatoma.	Thorup MB, etal., Acta Otolaryngol. 2014 Feb;134(2):124-34. doi: 10.3109/00016489.2013.847282. Epub 2013 Nov 21.
19.	Epiregulin (EREG) variation is associated with susceptibility to tuberculosis.	Thuong NT, etal., Genes Immun. 2012 Apr;13(3):275-81. doi: 10.1038/gene.2011.83. Epub 2011 Dec 15.
20.	Intestine-Specific Mttp Deletion Increases the Severity of Experimental Colitis and Leads to Greater Tumor Burden in a Model of Colitis Associated Cancer.	Xie Y, etal., PLoS One. 2013 Jun 21;8(6):e67819. doi: 10.1371/journal.pone.0067819. Print 2013.

Additional References at PubMed

PMID:7706296	PMID:9337852	PMID:9419975	PMID:10681561	PMID:12702554	PMID:14581411	PMID:15291759	PMID:16182244	PMID:18653716	PMID:31062344

Genomics

Comparative Map Data

Ereg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	17,027,287 - 17,041,062 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	17,027,287 - 17,041,062 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	17,029,016 - 17,042,901 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	18,347,942 - 18,361,825 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	17,040,063 - 17,053,944 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	18,577,620 - 18,591,395 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	18,576,355 - 18,591,394 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	18,486,956 - 18,500,731 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	18,521,069 - 18,534,844 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	18,521,068 - 18,534,844 (-)	NCBI
Celera	14	16,405,096 - 16,418,803 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

EREG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	74,365,145 - 74,388,749 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	74,365,145 - 74,388,749 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	75,230,862 - 75,254,466 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	75,449,724 - 75,473,341 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	75,595,894 - 75,619,512	NCBI
Celera	4	72,591,116 - 72,614,730 (+)	NCBI		Celera
Cytogenetic Map	4	q13.3	NCBI
HuRef	4	71,041,824 - 71,065,447 (+)	NCBI		HuRef
CHM1_1	4	75,266,712 - 75,290,347 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	77,708,788 - 77,732,398 (+)	NCBI		T2T-CHM13v2.0

Ereg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	91,222,476 - 91,241,508 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	91,222,481 - 91,241,505 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	91,074,617 - 91,093,649 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	91,074,622 - 91,093,646 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	91,503,643 - 91,522,675 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	92,149,822 - 92,168,846 (+)	NCBI		MGSCv36	mm8
Celera	5	89,212,781 - 89,230,978 (+)	NCBI		Celera
Cytogenetic Map	5	E1	NCBI
cM Map	5	44.78	NCBI

Ereg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955474	612,440 - 627,606 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955474	612,440 - 627,606 (+)	NCBI	ChiLan1.0	ChiLan1.0

EREG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	55,861,183 - 55,909,825 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	49,806,505 - 49,827,961 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	55,641,014 - 55,660,568 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	55,641,014 - 55,660,568 (-)	Ensembl	panpan1.1		panPan2

EREG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	62,857,325 - 62,877,831 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	62,856,709 - 62,877,760 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	62,545,018 - 62,568,011 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	63,687,189 - 63,710,239 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	63,687,115 - 63,707,828 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	63,301,985 - 63,325,016 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	62,783,802 - 62,806,817 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	63,926,759 - 63,949,788 (+)	NCBI		UU_Cfam_GSD_1.0

Ereg
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	12,874,664 - 12,893,710 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936598	1,328,803 - 1,344,360 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936598	1,328,803 - 1,336,141 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EREG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	70,351,311 - 70,372,569 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	70,351,316 - 70,372,530 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	74,502,143 - 74,521,363 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EREG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	22,898,998 - 22,924,922 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	22,901,862 - 22,920,678 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	1,191,580 - 1,214,724 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ereg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	1,339,518 - 1,353,429 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	1,339,017 - 1,353,869 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ereg
88 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	102
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000003716
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	3813074	18274691	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3813074	18274691	Rat
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	28035204	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11030812	30320092	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	14875168	30883947	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2										3	10
Below cutoff	1	2	10	2	15	2	1	1	1	8	14	1	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB078739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC108576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF074952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ266371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003716 ⟹ ENSRNOP00000003716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	17,027,287 - 17,041,062 (-)	Ensembl
Rnor_6.0 Ensembl	14	18,576,355 - 18,591,394 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106769 ⟹ ENSRNOP00000081571

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	17,027,287 - 17,031,974 (-)	Ensembl

RefSeq Acc Id:

NM_021689 ⟹ NP_067721

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	17,027,287 - 17,041,062 (-)	NCBI
Rnor_6.0	14	18,577,620 - 18,591,395 (-)	NCBI
Rnor_5.0	14	18,486,956 - 18,500,731 (-)	NCBI
RGSC_v3.4	14	18,521,069 - 18,534,844 (-)	RGD
Celera	14	16,405,096 - 16,418,803 (-)	RGD

Sequence:

show sequence

GCTCACTTGCCTGGCTGCTTGGAGTCACAGCGACTTGCTTGACCCTGGTCTCTGGATCAGCCCG
GTTCCTACTCAGCCACAGGCGCCTTGCTCCTATCCGCCGTCCAGCGCTTTGCGAGCTGCACCGA
GAGAAGGATGGAGACTTTCCCCGCCGCTTGGGTCCTGGCACTGCTTTGCCTTGGTTCCCACCTT
CTACAAGCAGTTATCAGCACAACCGTGATTCCGTCATGTATCCCAGAAGAATCCGAGGATAACT
GTACAGCTTTAGTTCAAATGGAAGACGATCCCCGTGTGGCGCAAGTGTTGATTACAAAGTGTAG
CTCTGACATGGACGGCTACTGCTTGCATGGACACTGTATCTACCTGGTGGACATGAGCGAGAAA
TACTGCAGATGTGAAGTGGGCTACACTGGTCTGCGGTGTGAACACTTCTTTCTGACTGTTCACC
AGCCCTTGAGCAGAGAATACGTTGCATTGACCGTGATTCTCGTTTTCCTCTTTCTTATTGTAAC
TGCTGGATCCATGTACTATTTCTGCAGATGGTACAGAAATCGCAAAAGTAAAAAATCAAGGGAA
GAATACGAGAGAGTGACCTCAGGGGGCCCAGGGTTGCCACAAGTCTGAACAGCGCCATCAAATT
GTGGACAAGGATGTGCAGCATGCCTGGCTGATGTCAATATTTTGTCATGTTAATAGTATTTATG
TTGGGTCATGTGTTAGGTCAATAACTATATTTTTAATACACTTGGAAAGTGTTTTATTTTTGAC
AGAAATATATTTGCTAATATATTATATGTAAAGTATTTAATGCCAAAAGAAATTTGATATTTTT
GT

hide sequence

Protein Sequences


Protein RefSeqs	NP_067721	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD10631	(Get FASTA)	NCBI Sequence Viewer
	ABB96115	(Get FASTA)	NCBI Sequence Viewer
	BAC44880	(Get FASTA)	NCBI Sequence Viewer
	EDL88580	(Get FASTA)	NCBI Sequence Viewer
	Q9Z0L5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_067721 ⟸ NM_021689
- Peptide Label:	preproprotein
- UniProtKB:	Q9Z0L5 (UniProtKB/TrEMBL), A0A8I5ZT85 (UniProtKB/TrEMBL)
- Sequence:	show sequence METFPAAWVLALLCLGSHLLQAVISTTVIPSCIPEESEDNCTALVQMEDDPRVAQVLITKCSSD MDGYCLHGHCIYLVDMSEKYCRCEVGYTGLRCEHFFLTVHQPLSREYVALTVILVFLFLIVTAG SMYYFCRWYRNRKSKKSREEYERVTSGGPGLPQV hide sequence

RefSeq Acc Id:

ENSRNOP00000003716 ⟸ ENSRNOT00000003716

RefSeq Acc Id:

ENSRNOP00000081571 ⟸ ENSRNOT00000106769

Protein Domains

EGF-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Z0L5-F1-model_v2	AlphaFold	Q9Z0L5	1-162	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620299	AgrOrtholog
BioCyc Gene	G2FUF-16215	BioCyc
Ensembl Genes	ENSRNOG00000002771	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000003716	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000081571.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000003716	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000106769.1	UniProtKB/TrEMBL
Gene3D-CATH	Laminin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	EGF-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:59325	UniProtKB/Swiss-Prot
NCBI Gene	59325	ENTREZGENE
PANTHER	PROEPIREGULIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10740	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	EREG	RGD
PhenoGen	Ereg	PhenoGen
PRINTS	EGFTGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	EGF_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	EGF/Laminin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZT85	ENTREZGENE, UniProtKB/TrEMBL
	EREG_RAT	UniProtKB/Swiss-Prot
	Q2VC84_RAT	UniProtKB/TrEMBL
	Q9Z0L5	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Ereg	epiregulin		epiregulin precursor	Name updated	625702	APPROVED
2002-08-07	Ereg	epiregulin precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in ovarian granulosa cells	628418
gene_process	mitogenic for rat aortic smooth muscle (RASM) cells, causing rapid EGF receptor activation, enhancing DNA synthesis	632743
gene_process	may play a role in FSH induced growth and maturation of ovarian follicles	628418
gene_process	growth factor belonging to epidermal growth factor family	628418
gene_regulation	induced by vasoactive GTP-binding protein-coupled receptor agonists such as angiotensin II (AII), endothelin-1 (ET-1), and alpha-thrombin (alpha-Thr)	632743
gene_regulation	Sp1/Sp3 proteins regulate via upstream sequence; rapid and strong induction in ovarian granulosa cells by FSH	628418
gene_transcript	5 exons; 125 bp region upstream of the start site important for transcription; one GT and two CT boxes located within this region important for expression	628418

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)