Advanced Search (OLGA)

Gene: Nptn (neuroplastin) Rattus norvegicus

Analyze

Symbol:

Nptn

Name:

neuroplastin

RGD ID:

620296

Description:

Enables cell adhesion molecule binding activity; transmembrane transporter binding activity; and type 1 fibroblast growth factor receptor binding activity. Involved in several processes, including homophilic cell adhesion via plasma membrane adhesion molecules; modulation of chemical synaptic transmission; and positive regulation of signal transduction. Located in several cellular components, including cell surface; inhibitory synapse; and presynaptic membrane. Is active in several cellular components, including GABA-ergic synapse; Schaffer collateral - CA1 synapse; and synaptic membrane. Orthologous to human NPTN (neuroplastin); INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glycoprotein 55; glycoprotein 55/65; glycoprotein 65; gp55/65; Sdfr1; SDR-1; stromal cell derived factor receptor 1; stromal cell-derived receptor 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPTN (neuroplastin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nptn (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nptn (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NPTN (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPTN (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nptn (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPTN (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NPTN (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nptn (neuroplastin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KIAA0408 (KIAA0408)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NPTN (neuroplastin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nptn (neuroplastin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nptna (neuroplastin a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	nptnb (neuroplastin b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nptnb (neuroplastin b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Bsg	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Bsg	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|SonicParanoid)
Caenorhabditis elegans (roundworm):	zig-11	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Xenopus tropicalis (tropical clawed frog):	nptn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	67,892,678 - 67,959,231 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	67,892,702 - 67,959,236 (+)	Ensembl				GRCr8
mRatBN7.2	8	58,996,873 - 59,063,402 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,996,887 - 59,063,401 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	64,527,258 - 64,593,535 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,804,796 - 62,871,073 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	60,669,503 - 60,735,787 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	63,379,062 - 63,445,694 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	63,379,087 - 63,445,686 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	63,149,031 - 63,215,298 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	62,389,893 - 62,466,128 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	58,456,063 - 58,522,680 (+)	NCBI		Celera
RGSC_v3.1	8	62,408,946 - 62,485,178 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bardet-Biedl syndrome (ISO)

Bloom syndrome (ISO)

Brugada syndrome 8 (ISO)

colorectal cancer (ISO)

Developmental Disease (ISO)

hypertension (ISO)

Myocardial Ischemia (ISO)

Neurodevelopmental Disorders (ISO)

schizophrenia (ISO)

Tay-Sachs disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenous acid (ISO)

asbestos (ISO)

atrazine (EXP)

benzo[a]pyrene (EXP,ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

clozapine (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

Deoxycorticosterone acetate (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

Mesaconitine (EXP)

methidathion (ISO)

methotrexate (ISO)

nitrates (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

olanzapine (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

potassium chloride (EXP)

potassium chromate (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rotenone (EXP)

SB 431542 (ISO)

sodium chloride (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (IBA)

cell adhesion (IEA)

dendrite self-avoidance (IBA)

excitatory synapse assembly (IEA,ISO)

homophilic cell adhesion via plasma membrane adhesion molecules (IBA,IDA)

intracellular calcium ion homeostasis (IEA,ISO)

long-term synaptic potentiation (IDA)

modulation of chemical synaptic transmission (IEA,ISO)

negative regulation of cytokine production (IEA,ISO,ISS)

nervous system development (IEA)

positive regulation of cytosolic calcium ion concentration (IDA)

positive regulation of ERK1 and ERK2 cascade (IDA)

positive regulation of fibroblast growth factor receptor signaling pathway (IDA)

positive regulation of long-term neuronal synaptic plasticity (IMP)

positive regulation of long-term synaptic potentiation (IMP)

positive regulation of neuron projection development (IDA)

positive regulation of protein localization (IMP)

positive regulation of protein phosphorylation (IDA)

regulation of cell adhesion (TAS)

regulation of macromolecule metabolic process (IEA)

regulation of multicellular organismal process (IEA)

regulation of receptor localization to synapse (IEA,ISO)

synapse organization (IEA,ISO)

trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission (EXP,IDA)

visual learning (IDA)

Cellular Component

axon (IBA)

cell surface (IDA)

dendrite (IDA,IEA)

GABA-ergic synapse (EXP,IDA)

glutamatergic synapse (EXP,IDA)

immunological synapse (IEA,ISO,ISS)

inhibitory synapse (IDA)

membrane (IEA,TAS)

plasma membrane (IBA,IEA,TAS)

postsynaptic density (IEA)

postsynaptic density membrane (IDA,IEP)

postsynaptic membrane (TAS)

presynaptic active zone membrane (EXP,IDA)

presynaptic membrane (IDA)

Schaffer collateral - CA1 synapse (EXP,IDA)

synapse (IEA)

synaptic membrane (IDA)

Molecular Function

cell adhesion molecule binding (IDA)

cell-cell adhesion mediator activity (IBA)

protein binding (ISO)

transmembrane transporter binding (IPI)

type 1 fibroblast growth factor receptor binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular profiling of synaptic vesicle docking sites reveals novel proteins but few differences between glutamatergic and GABAergic synapses.	Boyken J, etal., Neuron. 2013 Apr 24;78(2):285-97. doi: 10.1016/j.neuron.2013.02.027.
2.	The cell adhesion molecule neuroplastin-65 inhibits hippocampal long-term potentiation via a mitogen-activated protein kinase p38-dependent reduction in surface expression of GluR1-containing glutamate receptors.	Empson RM, etal., J Neurochem. 2006 Nov;99(3):850-60.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Characterization of novel glycoprotein components of synaptic membranes and postsynaptic densities, gp65 and gp55, with a monoclonal antibody.	Hill IE, etal., Brain Res. 1988 Sep 27;461(1):27-43.
5.	Distribution of transcript and protein isoforms of the synaptic glycoprotein neuroplastin in rat retina.	Kreutz MR, etal., Invest Ophthalmol Vis Sci. 2001 Jul;42(8):1907-14.
6.	Synaptic membrane glycoproteins gp65 and gp55 are new members of the immunoglobulin superfamily.	Langnaese K, etal., J Biol Chem 1997 Jan 10;272(2):821-7.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Neuroplastin-55 binds to and signals through the fibroblast growth factor receptor.	Owczarek S, etal., FASEB J. 2010 Apr;24(4):1139-50. Epub 2009 Dec 1.
10.	Neuroplastin-65 and a mimetic peptide derived from its homophilic binding site modulate neuritogenesis and neuronal plasticity.	Owczarek S, etal., J Neurochem. 2011 Jun;117(6):984-94. doi: 10.1111/j.1471-4159.2011.07269.x. Epub 2011 May 13.
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	The cell adhesion molecule neuroplastin-65 is a novel interaction partner of gamma-aminobutyric acid type A receptors.	Sarto-Jackson I, etal., J Biol Chem. 2012 Apr 20;287(17):14201-14. doi: 10.1074/jbc.M111.293175. Epub 2012 Mar 2.
13.	The synaptic glycoprotein neuroplastin is involved in long-term potentiation at hippocampal CA1 synapses.	Smalla KH, etal., Proc Natl Acad Sci U S A. 2000 Apr 11;97(8):4327-32.
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	Molecular characterisation and structural relationship of the synapse-enriched glycoproteins gp65 and gp55.	Willmott T, etal., J Neurochem. 1992 Jun;58(6):2037-43.

Additional References at PubMed

PMID:15489334	PMID:19581412	PMID:24260123	PMID:24554721	PMID:28827723	PMID:29476059

Genomics

Comparative Map Data

Nptn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	67,892,678 - 67,959,231 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	67,892,702 - 67,959,236 (+)	Ensembl				GRCr8
mRatBN7.2	8	58,996,873 - 59,063,402 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,996,887 - 59,063,401 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	64,527,258 - 64,593,535 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,804,796 - 62,871,073 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	60,669,503 - 60,735,787 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	63,379,062 - 63,445,694 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	63,379,087 - 63,445,686 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	63,149,031 - 63,215,298 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	62,389,893 - 62,466,128 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	58,456,063 - 58,522,680 (+)	NCBI		Celera
RGSC_v3.1	8	62,408,946 - 62,485,178 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

NPTN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	73,560,014 - 73,633,389 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	73,560,014 - 73,634,134 (-)	Ensembl			hg38	GRCh38
GRCh37	15	73,852,355 - 73,925,730 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	71,639,410 - 71,712,806 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	71,639,415 - 71,712,747	NCBI
Celera	15	50,730,984 - 50,804,846 (-)	NCBI		Celera
Cytogenetic Map	15	q24.1	NCBI
HuRef	15	50,683,637 - 50,757,046 (-)	NCBI		HuRef
CHM1_1	15	73,970,294 - 74,043,707 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	71,377,168 - 71,450,559 (-)	NCBI		T2T-CHM13v2.0

Nptn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	58,489,504 - 58,560,162 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	58,489,523 - 58,565,238 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	58,582,240 - 58,652,879 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	58,582,240 - 58,657,955 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	58,430,047 - 58,500,686 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	58,380,546 - 58,451,008 (+)	NCBI		MGSCv36	mm8
Celera	9	55,815,258 - 55,885,738 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI
cM Map	9	31.79	NCBI

Nptn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	3,938,403 - 4,004,059 (+)	Ensembl
ChiLan1.0	NW_004955450	3,938,403 - 4,002,694 (+)	NCBI	ChiLan1.0	ChiLan1.0

NPTN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	62,784,218 - 62,857,661 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	66,948,653 - 67,022,213 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	52,470,545 - 52,544,046 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	71,228,099 - 71,301,545 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	71,229,992 - 71,269,579 (-)	Ensembl			panPan2	panpan1.1

NPTN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	36,846,475 - 36,880,096 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	36,847,022 - 36,880,097 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	36,782,851 - 36,853,036 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	37,053,693 - 37,123,723 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	37,053,694 - 37,123,858 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	37,005,919 - 37,076,149 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	37,031,794 - 37,101,280 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	37,288,062 - 37,358,082 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nptn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	114,880,040 - 114,965,377 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	32,744,766 - 32,813,543 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	32,726,953 - 32,813,429 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPTN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	59,714,080 - 59,840,591 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	59,768,414 - 59,840,594 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	64,428,151 - 64,461,654 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPTN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	9,852,592 - 9,924,952 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	9,852,658 - 9,926,109 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	131,687,452 - 131,759,755 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nptn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	751,912 - 819,847 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624781	752,048 - 818,250 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Nptn
213 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	129
Count of miRNA genes:	108
Interacting mature miRNAs:	111
Transcripts:	ENSRNOT00000012091, ENSRNOT00000012295
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

Markers in Region

47.MMHAP30FLH5.seq

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	58,998,926 - 58,999,047 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	63,381,112 - 63,381,232	NCBI	Rnor6.0
Rnor_5.0	8	63,151,080 - 63,151,200	UniSTS	Rnor5.0
RGSC_v3.4	8	62,391,918 - 62,392,038	UniSTS	RGSC3.4
Celera	8	58,458,088 - 58,458,208	UniSTS
Cytogenetic Map	8	q24	UniSTS

RH137991

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	59,020,583 - 59,020,767 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	63,402,893 - 63,403,076	NCBI	Rnor6.0
Rnor_5.0	8	63,172,456 - 63,172,639	UniSTS	Rnor5.0
RGSC_v3.4	8	62,422,755 - 62,422,938	UniSTS	RGSC3.4
Celera	8	58,479,926 - 58,480,109	UniSTS
RH 3.4 Map	8	693.6	UniSTS
Cytogenetic Map	8	q24	UniSTS

AW554172

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	59,062,798 - 59,062,901 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	63,445,091 - 63,445,193	NCBI	Rnor6.0
Rnor_5.0	8	63,214,695 - 63,214,797	UniSTS	Rnor5.0
RGSC_v3.4	8	62,465,529 - 62,465,631	UniSTS	RGSC3.4
Celera	8	58,522,081 - 58,522,183	UniSTS
Cytogenetic Map	8	q24	UniSTS

UniSTS:236151

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	59,007,590 - 59,007,892 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	63,389,898 - 63,390,199	NCBI	Rnor6.0
Rnor_5.0	8	63,159,584 - 63,159,885	UniSTS	Rnor5.0
RGSC_v3.4	8	62,402,736 - 62,403,037	UniSTS	RGSC3.4
Celera	8	58,466,934 - 58,467,235	UniSTS
Cytogenetic Map	8	q24	UniSTS

MARC_21804-21805:1025095690:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	67,957,643 - 67,958,283 (+)	Marker Load Pipeline
mRatBN7.2	8	59,061,815 - 59,062,454 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	63,444,108 - 63,444,746	NCBI	Rnor6.0
Rnor_5.0	8	63,213,712 - 63,214,350	UniSTS	Rnor5.0
RGSC_v3.4	8	62,464,546 - 62,465,184	UniSTS	RGSC3.4
Celera	8	58,521,098 - 58,521,736	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001413347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001413348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001413349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_019380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001839232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC070947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X99337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X99338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012091 ⟹ ENSRNOP00000012091

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,892,709 - 67,959,236 (+)	Ensembl
mRatBN7.2 Ensembl	8	58,996,902 - 59,063,401 (+)	Ensembl
Rnor_6.0 Ensembl	8	63,379,087 - 63,445,686 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000012295 ⟹ ENSRNOP00000012295

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,892,702 - 67,959,231 (+)	Ensembl
mRatBN7.2 Ensembl	8	58,996,887 - 59,063,397 (+)	Ensembl
Rnor_6.0 Ensembl	8	63,379,190 - 63,445,642 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098300 ⟹ ENSRNOP00000078794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,938,549 - 67,959,236 (+)	Ensembl
mRatBN7.2 Ensembl	8	59,042,719 - 59,063,401 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107680 ⟹ ENSRNOP00000079570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,892,721 - 67,959,230 (+)	Ensembl
mRatBN7.2 Ensembl	8	58,997,041 - 59,063,401 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114027 ⟹ ENSRNOP00000096729

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,927,858 - 67,951,235 (+)	Ensembl
mRatBN7.2 Ensembl	8	59,032,027 - 59,055,024 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000140093 ⟹ ENSRNOP00000105040

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,892,729 - 67,959,231 (+)	Ensembl

RefSeq Acc Id:

NM_001413347 ⟹ NP_001400276

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,710 - 67,959,231 (+)	NCBI
mRatBN7.2	8	58,996,873 - 59,063,402 (+)	NCBI

RefSeq Acc Id:

NM_001413348 ⟹ NP_001400277

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,710 - 67,959,231 (+)	NCBI
mRatBN7.2	8	58,996,873 - 59,063,402 (+)	NCBI

RefSeq Acc Id:

NM_001413349 ⟹ NP_001400278

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,710 - 67,959,231 (+)	NCBI
mRatBN7.2	8	58,996,873 - 59,063,402 (+)	NCBI

RefSeq Acc Id:

NM_019380 ⟹ NP_062253

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,710 - 67,959,231 (+)	NCBI
mRatBN7.2	8	58,996,873 - 59,063,402 (+)	NCBI
Rnor_6.0	8	63,379,087 - 63,445,690 (+)	NCBI
Rnor_5.0	8	63,149,031 - 63,215,298 (+)	NCBI
RGSC_v3.4	8	62,389,893 - 62,466,128 (+)	RGD
Celera	8	58,456,063 - 58,522,680 (+)	RGD

Sequence:

show sequence

GGGACGGGGGAAGGACGGAGCTCGGCCGCTGCTGCCTCCCTCGTTCACTCCCTCGCGCTCTCGC
CCGCCCCCTCCCTCCCTCCCCTCCCTTCCCCGGGCCCGGGCCCGGACCATTCGCTGCTCGCTCT
CCGGCTAGGGAGGATGTCGGGCTCGTCGCTCCCCGGCGCCCTGGCCCTCTCGCTCTTGCTGGTC
TCTGGCTCGCTCCTCCCAGGGCCAGGCGCTGCTCAGAACGCTGGGTTTGTCAAGTCGCCCATGT
CAGAAACTAAGCTCACAGGGGACGCCTTTGAGCTGTACTGTGATGTGGTCGGGAGTCCCACGCC
AGAGATCCAGTGGTGGTACGCAGAAGTCAACCGGGCAGAGTCTTTCAGACAGCTGTGGGACGGT
GCTCGGAAGCGCCGTGTCACCGTAAACACCGCCTACGGGTCAAACGGCGTGAGTGTGCTGAGAA
TAACCCGGCTCACCTTGGAGGACTCTGGGACTTACGAGTGCAGGGCAAGCAACGACCCCAAACG
GAATGACTTGAGGCAAAACCCTTCCATAACATGGATTCGAGCCCAGGCCACCATAAGCGTCCTT
CAGAAACCAAGAATTGTCACCAGCGAAGAGGTCATTATTCGAGACAGCCTCCTTCCTGTCACCC
TGCAGTGTAACCTCACTTCCAGCTCTCACACCCTTATGTACAGCTACTGGACAAAGAATGGGGT
AGAACTCACTGCCACCCGTAAGAATGCCAGCAACATGGAATACAGGATCAATAAGCCAAGAGCT
GAGGATTCAGGCGAATACCACTGTGTATATCATTTTGTCAGCGCTCCTAAAGCAAATGCCACCA
TTGAAGTGAAAGCTGCTCCTGACATCACTGGCCATAAACGCAGTGAAAACAAAAATGAAGGGCA
GGATGCTATGATGTATTGCAAGTCTGTTGGCTACCCCCACCCGGAATGGATGTGGCGCAAGAAG
GAGAATGGTGTGTTTGAGGAGATTTCCAATAGCTCTGGTCGCTTCTTCATCATCAACAAGGAGA
ATTACACTGAATTGAATATTGTGAATCTCCAAATCACAGAAGATCCTGGAGAGTATGAATGTAA
TGCCACCAACTCCATTGGCTCTGCCTCCGTTTCCACAGTCCTCAGGGTACGGAGCCACCTTGCC
CCACTTTGGCCTTTCTTGGGAATTCTGGCTGAAATCATCATCCTTGTGGTGATCATTGTTGTGT
ATGAGAAGAGGAAGAGGCCAGATGAGGTTCCTGATGCCGGGCCAATGAAAACCAACTCTACCAA
CAATCACAAAGATAAAAACTTGCGCCAGAGAAACACAAATTAAGTACTGCTTTTAATCTCTTTA
GGTTCCTGAAAAATGATGGCAACATGACCTGCTAAGTTTTCTGCTTGGACCTCTTTGGTCTCTC
CCTTTCAAGTGAGCAACACCACAATGACCGTCTAAAGCATGCCTTATTTAGCCTCTCCTATAAG
GGTGACCTAGCCAGGTACATTTTAAACAATGCTTCAGTGTAGAAGGTGTAAACTATTTTGGGGC
TTGATGTGCTGTGAATGTTGCTTTCCCTCCCTTTGTTAAAATATTTAAATAGAAGCGAAAGGTC
CTTTGAGGATCAGATCATGCATGCGCCATTTTTTTACTTATACAGCTGTTAAATTGGCAAAGCT
CTAAATGCACTGCTGCCATCTAGTGATCATTTTGNAAAGTACAGCAAAACCTACAGATATATAC
AGTATATAAATATATATATATTCATATCNCNGGGGGTGGGAGAAATCCAAAATAAAGTCAAAGC
TTGTTTCATTTTTAAGCTGCTGATACTCATTCCTTATTATTTGTTGTCAGATGAGGAAGCTGCA
GTTCTGGTACAAAAAGATGAGAGTATAAACTTAAGTCTGTCATTCTAAGGGCTTACTTACCCTA
TAACTTTAAGAACCTGGAACAGTCCACTGAACGGCTAGAATGAATTGCAGTATATATGTATGAT
TGCTTTTTAAGTGACTATTTTTCCTTTTGTCAAATCATGTAAATTCTGAAATCTTTTGCACTGA
TGTGTCGAACCTTATTCTTGTATATTCAATCAAGGCAACTTTTATAATTTCCCATTTGTTTTCA
ATGACCCTGAAATGTTAATAGCATGGTGATATTCTATGCAACTCTAGTTATACCTTTTGGTTTG
ACACTGTATTTTCACATTGATTTCATGACTGATGATAGATTTTATAACCTGACTGGGTTCTCAT
GCGGTACTAACTGTAGATGCATGTACTTGTGTTCTGTGTAATTATTGAAGTGCAATGGTGTACA
AAAAAAGTGAATTCACCTGTTTTTAACAATAAAACATTGATAAAAAAAAAAAAAAAAAAAAAAA
A

hide sequence

RefSeq Acc Id:

XM_039082020 ⟹ XP_038937948

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,711 - 67,950,450 (+)	NCBI
mRatBN7.2	8	58,996,876 - 59,054,621 (+)	NCBI

RefSeq Acc Id:

XM_063266041 ⟹ XP_063122111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,711 - 67,950,569 (+)	NCBI

RefSeq Acc Id:

XR_005487909

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,712 - 67,959,231 (+)	NCBI
mRatBN7.2	8	58,996,876 - 59,063,390 (+)	NCBI

RefSeq Acc Id:

XR_010054023

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,892,678 - 67,959,231 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001400276	(Get FASTA)	NCBI Sequence Viewer
	NP_001400277	(Get FASTA)	NCBI Sequence Viewer
	NP_001400278	(Get FASTA)	NCBI Sequence Viewer
	NP_062253	(Get FASTA)	NCBI Sequence Viewer
	XP_038937948	(Get FASTA)	NCBI Sequence Viewer
	XP_063122111	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH70947	(Get FASTA)	NCBI Sequence Viewer
	CAA67711	(Get FASTA)	NCBI Sequence Viewer
	CAA67712	(Get FASTA)	NCBI Sequence Viewer
	EDL95683	(Get FASTA)	NCBI Sequence Viewer
	EDL95684	(Get FASTA)	NCBI Sequence Viewer
	EDL95685	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012091
	ENSRNOP00000012295
	ENSRNOP00000105040
GenBank Protein	P97546	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062253 ⟸ NM_019380
- Peptide Label:	isoform 2 precursor
- UniProtKB:	P97547 (UniProtKB/Swiss-Prot), Q6IRE8 (UniProtKB/Swiss-Prot), P97546 (UniProtKB/Swiss-Prot), A6J510 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGSSLPGALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQW WYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLR QNPSITWIRAQATISVLQKPRIVTSEEVIIRDSLLPVTLQCNLTSSSHTLMYSYWTKNGVELTA TRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAMM YCKSVGYPHPEWMWRKKENGVFEEISNSSGRFFIINKENYTELNIVNLQITEDPGEYECNATNS IGSASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDAGPMKTNSTNNHKD KNLRQRNTN hide sequence

Ensembl Acc Id:

ENSRNOP00000012295 ⟸ ENSRNOT00000012295

Ensembl Acc Id:

ENSRNOP00000012091 ⟸ ENSRNOT00000012091

RefSeq Acc Id:	XP_038937948 ⟸ XM_039082020
- Peptide Label:	isoform X2
- UniProtKB:	A6J510 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000096729 ⟸ ENSRNOT00000114027

Ensembl Acc Id:

ENSRNOP00000079570 ⟸ ENSRNOT00000107680

Ensembl Acc Id:

ENSRNOP00000078794 ⟸ ENSRNOT00000098300

RefSeq Acc Id:	NP_001400276 ⟸ NM_001413347
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A0A8L2Q5B1 (UniProtKB/TrEMBL), A6J511 (UniProtKB/TrEMBL), A6J510 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001400277 ⟸ NM_001413348
- Peptide Label:	isoform 3 precursor
- UniProtKB:	A6J512 (UniProtKB/TrEMBL), A0A8L2Q5G9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001400278 ⟸ NM_001413349
- Peptide Label:	isoform 4 precursor
- UniProtKB:	A0A8L2Q5G9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122111 ⟸ XM_063266041
- Peptide Label:	isoform X1
- UniProtKB:	A6J510 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000105040 ⟸ ENSRNOT00000140093

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97546-F1-model_v2	AlphaFold	P97546	1-393	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696044

Promoter ID:

EPDNEW_R6559

Type:

multiple initiation site

Name:

Nptn_1

Description:

neuroplastin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	63,379,197 - 63,379,257	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620296	AgrOrtholog
BioCyc Gene	G2FUF-30256	BioCyc
Ensembl Genes	ENSRNOG00000009029	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000012091	ENTREZGENE
	ENSRNOT00000012295	ENTREZGENE
	ENSRNOT00000107680	ENTREZGENE
	ENSRNOT00000140093	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7103647	IMAGE-MGC_LOAD
InterPro	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_I-set	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_sub2	UniProtKB/Swiss-Prot
KEGG Report	rno:56064	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91715	IMAGE-MGC_LOAD
NCBI Gene	56064	ENTREZGENE
PANTHER	NEUROPLASTIN	UniProtKB/Swiss-Prot
	PTHR10075	UniProtKB/Swiss-Prot
Pfam	I-set	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
PhenoGen	Nptn	PhenoGen
PIRSF	TyrPK_CSF1-R	UniProtKB/Swiss-Prot
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009029	RatGTEx
SMART	IGc2	UniProtKB/Swiss-Prot
	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZLH4_RAT	UniProtKB/TrEMBL
	A0A8I5ZN34_RAT	UniProtKB/TrEMBL
	A0A8I6AT28_RAT	UniProtKB/TrEMBL
	A0A8L2Q5B1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q5G9	ENTREZGENE, UniProtKB/TrEMBL
	A6J510	ENTREZGENE, UniProtKB/TrEMBL
	A6J511	ENTREZGENE, UniProtKB/TrEMBL
	A6J512	ENTREZGENE, UniProtKB/TrEMBL
	NPTN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P97547	ENTREZGENE
	Q6IRE8	ENTREZGENE
UniProt Secondary	P97547	UniProtKB/Swiss-Prot
	Q6IRE8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-22	Nptn	neuroplastin	Sdfr1	stromal cell derived factor receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Sdfr1	stromal cell derived factor receptor 1			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Sdfr1	stromal cell derived factor receptor 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains Ig domains	634005
gene_expression	expressed specifically in brain	634005

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD