Snap23 (synaptosome associated protein 23)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Snap23 (synaptosome associated protein 23) Rattus norvegicus

Analyze

Symbol:

Snap23 (Ensembl: AABR07053516.1)

Name:

synaptosome associated protein 23

RGD ID:

620221

Description:

Enables SNAP receptor activity and syntaxin binding activity. Involved in several processes, including exocytic insertion of neurotransmitter receptor to postsynaptic membrane; regulation of exocytosis; and vesicle-mediated transport in synapse. Located in plasma membrane. Part of SNARE complex. Is active in GABA-ergic synapse; glutamatergic synapse; and postsynapse. Orthologous to human SNAP23 (synaptosome associated protein 23); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; vasopressin signaling pathway; vasopressin signaling pathway via receptor type 2; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

SNAP-23; synaptosomal-associated protein 23; synaptosomal-associated protein 23 kD; synaptosomal-associated protein, 23 kD; vesicle-membrane fusion protein SNAP-23

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SNAP23 (synaptosome associated protein 23)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Snap23 (synaptosomal-associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Snap23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SNAP23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SNAP23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Snap23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SNAP23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SNAP23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Snap23 (synaptosome associated protein 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Snap23 (synaptosomal-associated protein 23)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SNAP23 (synaptosome associated protein 23)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	snap23.2 (synaptosome associated protein 23.2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	snap23.1 (synaptosome associated protein 23.1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ric-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Snap24	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Snap25	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	SEC9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	107,514,088 - 107,546,177 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	107,514,131 - 107,544,320 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	111,188,811 - 111,219,120 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	119,784,379 - 119,814,692 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	117,444,773 - 117,475,086 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	112,333,972 - 112,362,960 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	3	118,880,898 - 118,909,856 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	107,361,066 - 107,362,878 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	106,422,362 - 106,451,900 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

Myocardial Ischemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chrysene (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

ethanol (EXP)

finasteride (EXP)

flutamide (EXP)

formaldehyde (ISO)

fulvestrant (ISO)

graphite (EXP)

hexadecanoic acid (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

leflunomide (EXP)

melatonin (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodimethylamine (EXP)

nicotinamide (EXP)

oleic acid (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

SB 431542 (ISO)

Se-methyl-L-selenocysteine (ISO)

Se-methylselenocysteine (ISO)

sodium arsenate (ISO)

streptozocin (EXP)

succimer (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetraphene (ISO)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

exocytic insertion of neurotransmitter receptor to postsynaptic membrane (IDA,IMP)

exocytosis (IBA,ISO)

histamine secretion by mast cell (IEA,ISO)

membrane fusion (IDA)

protein transport (IMP)

protein-containing complex assembly (IDA)

regulation of exocytosis (IMP)

synaptic vesicle fusion to presynaptic active zone membrane (IBA)

synaptic vesicle priming (IBA)

vesicle-mediated transport (IMP)

vesicle-mediated transport in synapse (IDA,IMP)

Cellular Component

adherens junction (IEA,ISO)

azurophil granule (IEA,ISO)

cytoplasm (ISO)

cytoplasmic vesicle (ISO)

cytoplasmic vesicle membrane (IEA)

GABA-ergic synapse (IDA,IMP)

glutamatergic synapse (IDA)

mitochondrion (IEA,ISO)

neuron projection (IEA)

nucleoplasm (IEA,ISO)

plasma membrane (IBA)

plasma membrane (IDA)

plasma membrane (ISO)

postsynapse (IDA)

presynapse (IEA)

SNARE complex (IDA,ISO)

specific granule (IEA,ISO)

synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex (IBA)

terminal bouton (HDA)

Molecular Function

protein binding (IPI,ISO)

SNAP receptor activity (IBA,IDA)

syntaxin binding (IPI,ISO)

syntaxin-1 binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin responsive facilitative sugar transporter mediated glucose transport pathway (ISO)

vasopressin signaling pathway (TAS)

vasopressin signaling pathway via receptor type 2 (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Role of SNAP-23 in trafficking of H+-ATPase in cultured inner medullary collecting duct cells.	Banerjee A, etal., Am J Physiol Cell Physiol. 2001 Apr;280(4):C775-81.
2.	Physiology and pathophysiology of the vasopressin-regulated renal water reabsorption.	Boone M and Deen PM, Pflugers Arch. 2008 Sep;456(6):1005-24. Epub 2008 Apr 23.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Differential vesicular sorting of AMPA and GABAA receptors.	Gu Y, etal., Proc Natl Acad Sci U S A. 2016 Feb 16;113(7):E922-31. doi: 10.1073/pnas.1525726113. Epub 2016 Feb 2.
5.	The GLUT4 code.	Larance M, etal., Mol Endocrinol. 2008 Feb;22(2):226-33. Epub 2007 Aug 23.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	EHSH1/intersectin, a protein that contains EH and SH3 domains and binds to dynamin and SNAP-25. A protein connection between exocytosis and endocytosis?	Okamoto M, etal., J Biol Chem 1999 Jun 25;274(26):18446-54.
9.	Identification of SNAREs involved in synaptotagmin VII-regulated lysosomal exocytosis.	Rao SK, etal., J Biol Chem. 2004 May 7;279(19):20471-9. Epub 2004 Mar 1.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Membrane fusion between liposomes containing SNARE proteins involved in mast cell exocytosis.	Sakiyama H, etal., Inflamm Res. 2009 Mar;58(3):139-42.
14.	SNAP-23 participates in SNARE complex assembly in rat adipose cells.	St-Denis JF, etal., Biochem J 1999 Mar 15;338 ( Pt 3):709-15.
15.	A neuronal role for SNAP-23 in postsynaptic glutamate receptor trafficking.	Suh YH, etal., Nat Neurosci. 2010 Mar;13(3):338-43. doi: 10.1038/nn.2488. Epub 2010 Jan 31.
16.	Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation.	Suzuki K and Verma IM, Cell. 2008 Aug 8;134(3):485-95. doi: 10.1016/j.cell.2008.05.050.
17.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
18.	Insulin action on glucose transporters through molecular switches, tracks and tethers.	Zaid H, etal., Biochem J. 2008 Jul 15;413(2):201-15.

Additional References at PubMed

PMID:10510169	PMID:10825299	PMID:12477932	PMID:15035620	PMID:15542596	PMID:15611044	PMID:16516346	PMID:16677249	PMID:17575076	PMID:18253931	PMID:18457912	PMID:18505797
PMID:18535671	PMID:18588921	PMID:18973100	PMID:19056867	PMID:19515809	PMID:19735702	PMID:20458337	PMID:20519516	PMID:21423176	PMID:22713544	PMID:23376485	PMID:23380067
PMID:25468996	PMID:26733245	PMID:26930561	PMID:28119011	PMID:28240595	PMID:29485121	PMID:33213278	PMID:34147527

Genomics

Comparative Map Data

Snap23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	107,514,088 - 107,546,177 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	107,514,131 - 107,544,320 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	111,188,811 - 111,219,120 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	119,784,379 - 119,814,692 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	117,444,773 - 117,475,086 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	112,333,972 - 112,362,960 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	3	118,880,898 - 118,909,856 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	107,361,066 - 107,362,878 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	106,422,362 - 106,451,900 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

SNAP23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	42,491,129 - 42,533,058 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	15	42,491,233 - 42,545,356 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	42,787,832 - 42,825,256 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	40,575,127 - 40,612,548 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	19,555,540 - 19,592,958 (+)	NCBI		Celera
Cytogenetic Map	15	q15.1-q15.2	NCBI
HuRef	15	19,635,345 - 19,673,071 (+)	NCBI		HuRef
CHM1_1	15	42,905,940 - 42,943,698 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	40,301,674 - 40,339,102 (+)	NCBI		T2T-CHM13v2.0

Snap23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	120,398,137 - 120,431,885 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	120,398,152 - 120,431,736 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	120,567,655 - 120,601,255 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	120,567,671 - 120,601,255 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	120,393,407 - 120,426,458 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	120,259,112 - 120,292,163 (+)	NCBI		MGSCv36	mm8
Celera	2	121,720,414 - 121,753,492 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	60.37	NCBI

Snap23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	9,190,623 - 9,225,103 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	9,191,123 - 9,225,103 (+)	NCBI	ChiLan1.0	ChiLan1.0

SNAP23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	15	39,608,479 - 39,650,759 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	39,612,445 - 39,650,759 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	15	21,456,247 - 21,494,340 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SNAP23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	9,453,931 - 9,493,506 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	9,456,084 - 9,492,329 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	9,511,812 - 9,550,895 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	9,589,363 - 9,628,453 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	9,591,559 - 9,629,150 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	9,508,701 - 9,547,616 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	9,615,029 - 9,654,170 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	9,747,912 - 9,786,884 (+)	NCBI		UU_Cfam_GSD_1.0

Snap23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	87,932,868 - 87,970,585 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	5,784,054 - 5,820,571 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	5,784,070 - 5,818,644 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SNAP23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	128,847,931 - 128,888,947 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	128,849,465 - 128,888,972 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	143,742,362 - 143,781,715 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SNAP23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	40,443,478 - 40,485,211 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	40,442,615 - 40,482,346 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	100,526,825 - 100,568,648 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snap23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	9,610,308 - 9,641,933 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	9,609,777 - 9,643,670 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Snap23
79 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	140
Count of miRNA genes:	113
Interacting mature miRNAs:	116
Transcripts:	ENSRNOT00000074392
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat

Markers in Region

BF386077

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,530,721 - 107,530,875 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,350,559 - 112,350,712	NCBI	Rnor6.0
Rnor_5.0	3	118,897,455 - 118,897,608	UniSTS	Rnor5.0
Celera	3	106,438,944 - 106,439,097	UniSTS
RH 3.4 Map	3	941.3	UniSTS
Cytogenetic Map	3	q25	UniSTS

RH127866

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,543,975 - 107,544,166 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,362,616 - 112,362,806	NCBI	Rnor6.0
Rnor_5.0	3	118,909,512 - 118,909,702	UniSTS	Rnor5.0
RGSC_v3.4	3	107,362,534 - 107,362,724	UniSTS	RGSC3.4
Celera	3	106,451,556 - 106,451,746	UniSTS
RH 3.4 Map	3	939.8	UniSTS
Cytogenetic Map	3	q25	UniSTS

RH140008

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,543,477 - 107,543,664 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,362,118 - 112,362,304	NCBI	Rnor6.0
Rnor_5.0	3	118,909,014 - 118,909,200	UniSTS	Rnor5.0
RGSC_v3.4	3	107,362,036 - 107,362,222	UniSTS	RGSC3.4
Celera	3	106,451,058 - 106,451,244	UniSTS
RH 3.4 Map	3	946.7	UniSTS
Cytogenetic Map	3	q25	UniSTS

RH141559

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,543,039 - 107,543,237 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,361,680 - 112,361,877	NCBI	Rnor6.0
Rnor_5.0	3	118,908,576 - 118,908,773	UniSTS	Rnor5.0
RGSC_v3.4	3	107,361,598 - 107,361,795	UniSTS	RGSC3.4
Celera	3	106,450,620 - 106,450,817	UniSTS
RH 3.4 Map	3	940.5	UniSTS
Cytogenetic Map	3	q25	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF052596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000074392 ⟹ ENSRNOP00000064401

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	107,514,150 - 107,542,815 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096953 ⟹ ENSRNOP00000091304

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	107,514,131 - 107,544,320 (+)	Ensembl

RefSeq Acc Id:

NM_022689 ⟹ NP_073180

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	107,514,138 - 107,544,320 (+)	NCBI
Rnor_6.0	3	112,333,972 - 112,362,960 (+)	NCBI
Rnor_5.0	3	118,880,898 - 118,909,856 (+)	NCBI
RGSC_v3.4	3	107,361,066 - 107,362,878 (+)	RGD
Celera	3	106,422,362 - 106,451,900 (+)	RGD

Sequence:

show sequence

CGGATCTTAAGAGAGTCCAAGAGCAGCGGGGCCCGGAGAGGAGTGGCTGGAGCAGCCGGGTGAG
CCTTCTGAAAAGTAGCTGAGTGAGCTGGTCAGCGGGACAGAGTATCCATATTTCCGTTTCTGTG
TCCAATAGTTTTGACTCATCATGGATGATCTATCACCAGAAGAAATTCAGCTTCGGGCTCACCA
AGTTACTGATGAGTCTCTGGAAAGCACAAGGAGAATCCTGGGTTTAGCCATTGAGTCTCAGGAT
GCAGGAATCAAGACTATCACTATGCTGGATGAGCAAGGGGAACAACTAAATCGCATAGAAGAAG
GCATGGACCAAATAAATAAAGACATGAGAGAGGCAGAGAAGACTTTAACAGAACTCAACAAGTG
TTGTGGCCTCTGCGTCTGCCCTTGTAATAGGACCAAGAACTTTGAGTCTGGAAAGAACTATAAG
GCAACATGGGGTGATGGTGGAGACAGCTCACCTAGCAATGTGGTATCTAAGCAACCAAGCCGGA
TAACAAATGGTCAGCCTCAGCAGACTACAGGAGCGGCCAGCGGTGGATACATTAAACGCATAAC
TAATGATGCCAGAGAAGATGAGATGGAAGAGAACCTGACTCAAGTGGGCAGCATCCTAGGGAAC
CTAAAGAACATGGCTCTGGATATGGGCAATGAAATTGATGCTCAAAACCAGCAAATACAGAAGA
TCACAGAAAAGGCTGACACCAACAAGAATCGCATTGACATTGCCAATACAAGAGCAAAGAAACT
CATTGACAGCTAAAACCCTGCTGTACTTCTTTACCTGTTAACTCAGTCTCGGGCTCCTGCTGAG
TCTTTTCTTACTCAGTTTGAAAGACTGTGCGAGAAGGGCGGGAGGAGGATCCCTCCTCCTTCCT
TCCTTTCTGTCTTTTGGGGTAGGTTCTTGCTCAGGCGTTCTTACAGTCTTTCTCAGTTTACTCT
TGTAGGCTGCTTTCTGTACATCACTTAGTCTCTCCATCTCGTCATTTAGCTTTTGTGTTCAAGA
CTTGGAAGCATTGCCAAAGAGCCATGAAGGGAGGCAGCTGGATAAGTAGCTTTTGCCATTATTG
GTTGGTTGGCTTGGTTTTGGTTTGGTTTTGGTTTTATGGTAAAGAGCAAGAGGAAGGAAGAAGA
AATGAAGTGACTCATTAAAGAAACTACAGGTCACAAAAAACCCTCAGTGCTTGGGGTAGGAGCT
TTCACACGTGTTTTGTTCTACACTGTTTTTCAGCTTCTGCTCCAAAGAGAGTACAGTGAGTTTT
CCAGAAGTGAGCTTCACTCCTAAATCCTTAGTGATTTGGGTATAAACGTAGGCTCTTGGGTCCC
GTTTCATATTGCACATGCAGGAACACTATATAAACGAGTGCCTTTTATTCTCATACAGTAAGTC
ATAGCATGGTCCCATTGCAGGCCTGTTAACTTCATGGAGTTGTCAGTAGCCTTGAAAAGATGTA
CATATATATGTGAAATCGGAGACTTCCTCACTAAAGCAGGGTGTATCATGTGAATTCAGATTTA
CCTCATAAGAATTATGTTTAGATATGAAAAAGACTTGTTTTGATCTCAGGTAGAAAAATAGATT
GCTTTGAGTTTTGTATAGTTTTAGACATTTAAAAAGTTATAATCTGTTACTAAAAGTTGTTTGG
AAAATTATGCCTTTGATTAATTATTGATGACCACACTGCCATTCTCTCTGCCTTACACACAGAA
TCAAGTTTGTGTAGACCCTGAAGTGTTAGGAAAGCTGAACTGGTATTTGTCACCTTTGTTTAAA
AATCAGCATGTACAATTGCTGATTGTAGATCGCAATTAGCGCAAAGTAGATCGGTTTGACCAGT
AACCATTGCTTGATTCTTACAATTAAATTTTGTAATTAATGGTATTGTTCTTCAAATAGGTGAT
GTTTCTATGACTTATTTGTAGGGGCAATCATTTTACCAGCTTTTGTTAACATTAGATAAAGCAA
ATGTCCATACGTCATGCACTCCAATAGAAAGTTGCATTAGCTCTTCTCTAATTTTCACCAGAAG
TGTGTACAGGACTTCCTACGGTTTGCTTTGAGTTCATTCTAGACATTACTTGTCTTAGTCGTTT
GAACTTAAATACACTACTGAGTATTTCTGAGTGAGAATTCAAGTCATGTATTGAAGAAGATGCA
TCTAGCATAGCAACATTCAGAGGGTGAAGAGGACAGTGTGCAAAACAAAGCAGTGTTCCATGCC
AGAGTGAAGAGCTTATTGGGTACAGATACCTAATGTATGAAGTATGGCTGAGTGTAAAACACTG
GACTGTGCTGTGCCCAAAAGTGCTTCCCTTAGTCATTTAAAAACAACATGCTGATTTGTCCAAA
GGAACAGTACCAAAAGGTAGTATCCAAGGTATATTTGGCTAGAATATGCACTAAAGCAACCCTT
TGCTCTTGCTGGCTGGTGTGAATGCATGCTTATTTCTTGCCTTAATTTCTATATCTGTAAATGG
GAATTAATAAATCCTGTTTTATAAACTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105811 ⟹ XP_038961739

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	107,514,088 - 107,546,177 (+)	NCBI

RefSeq Acc Id:

XM_039105812 ⟹ XP_038961740

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	107,514,091 - 107,546,177 (+)	NCBI

RefSeq Acc Id:

XM_039105813 ⟹ XP_038961741

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	107,514,093 - 107,546,177 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_073180	(Get FASTA)	NCBI Sequence Viewer
	XP_038961739	(Get FASTA)	NCBI Sequence Viewer
	XP_038961740	(Get FASTA)	NCBI Sequence Viewer
	XP_038961741	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC06031	(Get FASTA)	NCBI Sequence Viewer
	AAI27495	(Get FASTA)	NCBI Sequence Viewer
	EDL79953	(Get FASTA)	NCBI Sequence Viewer
	O70377	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_073180 ⟸ NM_022689

- UniProtKB:

A0JPL8 (UniProtKB/Swiss-Prot), O70377 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDDLSPEEIQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINK
DMREAEKTLTELNKCCGLCVCPCNRTKNFESGKNYKATWGDGGDSSPSNVVSKQPSRITNGQPQ
QTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADT
NKNRIDIANTRAKKLIDS

hide sequence

RefSeq Acc Id:	XP_038961739 ⟸ XM_039105811
- Peptide Label:	isoform X1
- UniProtKB:	M0R4V3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961740 ⟸ XM_039105812
- Peptide Label:	isoform X1
- UniProtKB:	M0R4V3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961741 ⟸ XM_039105813
- Peptide Label:	isoform X2
- UniProtKB:	A0JPL8 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:

ENSRNOP00000064401 ⟸ ENSRNOT00000074392

RefSeq Acc Id:

ENSRNOP00000091304 ⟸ ENSRNOT00000096953

Protein Domains

t-SNARE coiled-coil homology

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R4V3-F1-model_v2	AlphaFold	M0R4V3	1-210	view protein structure
AF-O70377-F1-model_v2	AlphaFold	O70377	1-210	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620221	AgrOrtholog
BioCyc Gene	G2FUF-48161	BioCyc
Ensembl Genes	ENSRNOG00000050552	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000064401	ENTREZGENE
	ENSRNOP00000064401.3	UniProtKB/TrEMBL
	ENSRNOP00000091304	ENTREZGENE
	ENSRNOP00000091304.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074392	ENTREZGENE
	ENSRNOT00000074392.3	UniProtKB/TrEMBL
	ENSRNOT00000096953	ENTREZGENE
	ENSRNOT00000096953.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.110	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8361815	IMAGE-MGC_LOAD
InterPro	SNAP-25	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	T_SNARE_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64630	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156644	IMAGE-MGC_LOAD
NCBI Gene	64630	ENTREZGENE
PANTHER	SYNAPTOSOMAL ASSOCIATED PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNAPTOSOMAL-ASSOCIATED PROTEIN 23	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SNAP-25	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Snap23	PhenoGen
PROSITE	T_SNARE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	t_SNARE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SNARE fusion complex	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0JPL8	ENTREZGENE
	M0R4V3	ENTREZGENE, UniProtKB/TrEMBL
	O70377	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	A0JPL8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-21	Snap23	synaptosome associated protein 23	Snap23	synaptosomal-associated protein 23	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Snap23	synaptosomal-associated protein 23		synaptosomal-associated protein, 23 kD	Name updated	1299863	APPROVED
2002-08-07	Snap23	synaptosomal-associated protein, 23 kD			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	interacts with syntaxin 4 in the plasma membrane	634161
gene_process	involved in the process of membrane fusion and synaptic vesicle exocytosis	634161

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations