Numb (NUMB, endocytic adaptor protein)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Numb (NUMB, endocytic adaptor protein) Rattus norvegicus

Analyze

Symbol:

Numb

Name:

NUMB, endocytic adaptor protein

RGD ID:

620107

Description:

Predicted to enable several functions, including alpha-catenin binding activity; beta-catenin binding activity; and cadherin binding activity. Involved in positive regulation of dendrite morphogenesis; regulation of neuron differentiation; and regulation of postsynapse assembly. Located in apical part of cell and dendritic spine. Is active in glutamatergic synapse and postsynaptic density. Orthologous to human NUMB (NUMB endocytic adaptor protein); PARTICIPATES IN altered Notch signaling pathway; altered Notch signaling pathway involving the macromolecules modifying the main players; Notch signaling pathway; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC188364; numb gene homolog; numb gene homolog (Drosophila); numb homolog; numb homolog (Drosophila)

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NUMB (NUMB endocytic adaptor protein)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Numb (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Numb (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NUMB (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NUMB (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Numb (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NUMB (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NUMB (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Numb (NUMB endocytic adaptor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Numb (NUMB endocytic adaptor protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NUMB (NUMB endocytic adaptor protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	numb (NUMB endocytic adaptor protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	num-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	numb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	103,431,400 - 103,553,422 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	103,431,400 - 103,553,354 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	103,594,476 - 103,638,726 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	103,893,689 - 103,937,937 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	103,263,154 - 103,307,402 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	107,279,917 - 107,325,345 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	107,279,920 - 107,325,345 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	118,218,526 - 118,262,951 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	107,838,216 - 107,882,302 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	107,842,337 - 107,845,590 (-)	NCBI
Celera	6	101,261,488 - 101,306,906 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bortezomib (ISO)

caffeine (ISO)

cisplatin (ISO)

coumarin (ISO)

DAPT (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

Diisodecyl phthalate (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

ethanol (ISO)

finasteride (EXP)

formaldehyde (ISO)

gentamycin (EXP)

hydralazine (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead nitrate (ISO)

menadione (ISO)

nickel atom (ISO)

oxaliplatin (EXP)

ozone (ISO)

PCB138 (EXP)

PhIP (EXP)

potassium chromate (ISO)

quercetin (EXP,ISO)

sulindac (EXP)

temozolomide (ISO)

thioacetamide (EXP)

topotecan (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

vitamin K (EXP)

warfarin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adherens junction organization (IEA,ISO)

axonogenesis (IEA,ISO)

cell differentiation (NAS)

cell population proliferation (NAS)

forebrain development (ISO)

lateral ventricle development (IEA,ISO)

lung epithelial cell differentiation (ISO)

negative regulation of Notch signaling pathway (ISO)

negative regulation of protein localization to plasma membrane (IEA,ISO)

nervous system development (IEA,ISO)

neuroblast division in subventricular zone (IEA,ISO)

neuroblast proliferation (ISO)

positive regulation of cell migration (IEA,ISO)

positive regulation of dendrite morphogenesis (IMP)

positive regulation of neurogenesis (IBA,IEA,ISO)

positive regulation of polarized epithelial cell differentiation (ISO)

regulation of neuron differentiation (IMP)

regulation of postsynapse assembly (IDA,IMP)

regulation of postsynaptic neurotransmitter receptor internalization (IEA,ISO)

Cellular Component

apical part of cell (IDA,IEA,ISO)

apical plasma membrane (ISO)

basolateral plasma membrane (IBA,IEA,ISO)

clathrin-coated pit (IEA,ISO)

clathrin-coated vesicle (IEA,ISO)

cytoplasm (IBA,ISO)

cytoplasmic vesicle (IBA,ISO)

dendritic spine (IDA)

early endosome (IEA,ISO)

endosome membrane (IEA)

glutamatergic synapse (IDA,IEA,IMP,ISO)

nucleus (ISO)

plasma membrane (IEA,ISO)

postsynaptic density (IDA,IMP)

Molecular Function

alpha-catenin binding (IEA,ISO)

beta-catenin binding (IEA,ISO)

cadherin binding (IEA,ISO)

phospholipid binding (ISO)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

altered Notch signaling pathway (ISS)

altered Notch signaling pathway involving the macromolecules modifying the main players (ISS)

Notch signaling pathway (IEA,ISO,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	The orientation of cell division influences cell-fate choice in the developing mammalian retina.	Cayouette M and Raff M, Development. 2003 Jun;130(11):2329-39.
2.	Involvement of numb in vertebrate retinal development: evidence for multiple roles of numb in neural differentiation and maturation.	Dooley CM, etal., J Neurobiol 2003 Feb 5;54(2):313-25.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Developmental changes in Notch1 and numb expression mediated by local cell-cell interactions underlie progressively increasing delta sensitivity in neural crest stem cells.	Kubu CJ, etal., Dev Biol 2002 Apr 1;244(1):199-214.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Role of numb in dendritic spine development with a Cdc42 GEF intersectin and EphB2.	Nishimura T, etal., Mol Biol Cell. 2006 Mar;17(3):1273-85. Epub 2006 Jan 4.
8.	Loss of negative regulation by Numb over Notch is relevant to human breast carcinogenesis.	Pece S, etal., J Cell Biol 2004 Oct 25;167(2):215-21. Epub 2004 Oct 18.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Mammalian NUMB is an evolutionarily conserved signaling adapter protein that specifies cell fate.	Verdi JM, etal., Curr Biol. 1996 Sep 1;6(9):1134-45.

Additional References at PubMed

PMID:10551807	PMID:10841580	PMID:11782429	PMID:12361975	PMID:12410312	PMID:12477932	PMID:12876431	PMID:12942088	PMID:14687546	PMID:15598981	PMID:16105844	PMID:17022975
PMID:17174898	PMID:17589506	PMID:19581412	PMID:21150807	PMID:21423176	PMID:21448337	PMID:22174158	PMID:23132739	PMID:25468996	PMID:25941814	PMID:26437238	PMID:26621723
PMID:27358480	PMID:29063319	PMID:29362432	PMID:33060633

Genomics

Comparative Map Data

Numb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	103,431,400 - 103,553,422 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	103,431,400 - 103,553,354 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	103,594,476 - 103,638,726 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	103,893,689 - 103,937,937 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	103,263,154 - 103,307,402 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	107,279,917 - 107,325,345 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	107,279,920 - 107,325,345 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	118,218,526 - 118,262,951 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	107,838,216 - 107,882,302 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	107,842,337 - 107,845,590 (-)	NCBI
Celera	6	101,261,488 - 101,306,906 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

NUMB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	73,275,216 - 73,458,546 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	14	73,275,107 - 73,458,617 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	73,741,924 - 73,925,252 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	72,811,671 - 72,995,039 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	72,811,670 - 72,995,039	NCBI
Celera	14	53,805,138 - 53,989,581 (-)	NCBI		Celera
Cytogenetic Map	14	q24.2-q24.3	NCBI
HuRef	14	53,907,407 - 54,092,058 (-)	NCBI		HuRef
CHM1_1	14	73,681,206 - 73,864,710 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	67,480,648 - 67,666,518 (-)	NCBI		T2T-CHM13v2.0

Numb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	83,840,808 - 83,968,713 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	83,840,808 - 83,968,708 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	83,794,034 - 83,921,942 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	83,794,034 - 83,921,934 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	85,136,389 - 85,183,293 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	84,685,187 - 84,732,091 (-)	NCBI		MGSCv36	mm8
Celera	12	85,241,999 - 85,288,880 (-)	NCBI		Celera
Cytogenetic Map	12	D1	NCBI

Numb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955523	2,025,652 - 2,076,037 (+)	NCBI	ChiLan1.0	ChiLan1.0

NUMB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	14	72,714,555 - 72,905,062 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	72,714,555 - 72,798,037 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	14	53,854,280 - 54,046,410 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

NUMB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	46,620,444 - 46,781,564 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	46,607,556 - 46,782,175 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	46,305,647 - 46,465,562 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	46,848,975 - 47,010,155 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	46,848,978 - 47,010,244 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	46,516,801 - 46,677,888 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	46,532,509 - 46,695,082 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	46,923,765 - 47,086,380 (-)	NCBI		UU_Cfam_GSD_1.0

Numb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	29,325,965 - 29,488,760 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936488	2,579,017 - 2,742,961 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUMB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	96,624,274 - 96,799,288 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	96,624,270 - 96,798,690 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	102,419,471 - 102,504,648 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NUMB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	50,528,839 - 50,718,288 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	50,530,266 - 50,605,942 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	38,714,520 - 38,899,034 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Numb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624734	27,994,662 - 28,144,719 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Numb
418 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	292
Count of miRNA genes:	103
Interacting mature miRNAs:	109
Transcripts:	ENSRNOT00000013026, ENSRNOT00000042594, ENSRNOT00000049481
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat

Markers in Region

BE120274

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	103,477,719 - 103,477,916 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	107,326,077 - 107,326,273	NCBI	Rnor6.0
Rnor_5.0	6	118,217,598 - 118,217,794	UniSTS	Rnor5.0
RGSC_v3.4	6	107,883,034 - 107,883,230	UniSTS	RGSC3.4
Celera	6	101,307,638 - 101,307,834	UniSTS
RH 3.4 Map	6	734.2	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH137440

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	103,431,930 - 103,432,126 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	107,279,106 - 107,279,301	NCBI	Rnor6.0
Rnor_5.0	6	118,263,567 - 118,263,762	UniSTS	Rnor5.0
RGSC_v3.4	6	107,837,405 - 107,837,600	UniSTS	RGSC3.4
Celera	6	101,260,677 - 101,260,872	UniSTS
RH 3.4 Map	6	734.7	UniSTS
Cytogenetic Map	6	q31	UniSTS

AI407449

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	103,431,607 - 103,431,711 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	107,278,783 - 107,278,886	NCBI	Rnor6.0
Rnor_5.0	6	118,263,982 - 118,264,085	UniSTS	Rnor5.0
RGSC_v3.4	6	107,837,082 - 107,837,185	UniSTS	RGSC3.4
Celera	6	101,260,354 - 101,260,457	UniSTS
RH 3.4 Map	6	731.9	UniSTS
Cytogenetic Map	6	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	57	41	19	41			74	35	41	11
Low		8					8	11					8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001411953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001411954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001411955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001411956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_133287	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB210108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY077616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ336702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ336703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ336704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ336705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000013026 ⟹ ENSRNOP00000013026

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	103,432,414 - 103,553,354 (-)	Ensembl
Rnor_6.0 Ensembl	6	107,279,920 - 107,325,345 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000042594 ⟹ ENSRNOP00000042586

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	103,431,403 - 103,477,007 (-)	Ensembl
Rnor_6.0 Ensembl	6	107,279,920 - 107,325,345 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000049481 ⟹ ENSRNOP00000048410

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	103,431,400 - 103,553,326 (-)	Ensembl
Rnor_6.0 Ensembl	6	107,279,920 - 107,325,345 (-)	Ensembl

RefSeq Acc Id:

NM_133287 ⟹ NP_579821

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,432,742 - 103,476,988 (-)	NCBI
Rnor_6.0	6	107,279,917 - 107,325,345 (-)	NCBI
Rnor_5.0	6	118,218,526 - 118,262,951 (+)	NCBI
RGSC_v3.4	6	107,838,216 - 107,882,302 (-)	RGD
Celera	6	101,261,488 - 101,306,906 (-)	RGD

Sequence:

show sequence

ATGAACAAACTACGGCAGAGTTTCAGGAGAAAGAAAGATGTTTACGTCCCAGAGGCCAGCCGTC
CACATCAGTGGCAGACAGATGAAGAGGGAGTCCGCACTGGAAAGTGCAGCTTCCCAGTTAAGTA
CCTTGGCCACGTAGAGGTTGATGAGTCAAGAGGAATGCACATCTGTGAAGATGCCGTCAAAAGA
TTGAAAGCTACGGGAAAGAAAGCAGTGAAGGCCGTTCTGTGGGTATCAGCAGATGGACTCAGAG
TTGTGGATGAAAAAACTAAGGACCTCATAGTTGACCAGACAATAGAAAAAGTTTCTTTCTGCGC
CCCCGATAGGAACTTTGACAGAGCCTTTTCTTACATATGTCGAGATGGCACCACTCGGCGATGG
ATCTGTCATTGCTTCATGGCTGTCAAAGACACGGGGGAAAGACTGAGCCATGCCGTGGGCTGTG
CTTTTGCAGCCTGTTTAGAGCGTAAACAGAAGCGGGAAAAGGAGTGTGGAGTCACTGCTACTTT
CGATGCCAGTAGAACCACTTTTACAAGAGAAGGATCATTCCGTGTCACAACTGCCACAGAACAA
GCTGAAAGAGAGGAGATCATGAAACAGTTGCAAGATGCCAAGAAAGCTGAGACAGATAAGACCG
TTGGTCCATCAGTGGCTCCTGGCAACAGTGCTCCATCGCCGTCCTCTCCCACCTCCCCAACTCT
GGATCCCACTGCTTCTTTAGAGATGAACAATCCTCATGCTATCCCACGCCGGCATGCACCAATT
GAACAGCTTGCTCGCCAAGGCTCTTTCCGGGGATTTCCTGCTCTTAGCCAGAAGATGTCACCCT
TTAAACGCCAGCTGTCCCTACGCATCAATGAGCTGCCTTCCACTATGCAGAGGAAGACTGATTT
CCCAATAAAAAACACAGTGCCTGAGGTGGAAGGAGAGGCAGAAAGCATCAGCTCCCTGTGCTCC
CAGATCACCAGTGCCTTCAGCACACCCTGTGAGGACCCCTTCTCCTCTGCCCCAATGACCAAAC
CAGTGACATTAGTGGCACCACAGTCTCCTGTGTTACAAGGGACTGAGTGGGGTCAGTCTTCTGG
TGCTGCCTCTCCAGGTCTCTTCCAGGCTGGTCACAGACGCACTCCCTCTGAGGCTGACCGTTGG
TTAGAAGAAGTATCAAAAAGTGTGCGGGCCCAGCAGCCGCAGGCCTCAGCCGCCCCTCTGCAGC
CAGTTCTGCAGCCTCCTCCGCCCGCTGCCATTGCCCCTCCAGCACCTCCTTTCCAAGGACATGC
ATTCCTCACTTCTCAGCCTGTGCCAGTGGGTGTGGTCCCACCCCTACAACCAGCCTTTGTCTCT
ACCCAGTCCTACCCTGTGGCCAATGGGATGCCCTATCCAGCCTCTAATGTGCCTGTAGTGGGCA
TCACCCCATCCCAGATGGTAGCCAATGTGTTTGGCACTGCAGGCCATCCTCAGGCCACTCATCC
ACATCAGTCCCCAAGCCTGGCCAAGCAGCAGACATTCCCTCAATATGAGACAAGTAGTGCTACC
ACCAGTCCCTTCTTTAAGCCTTCTGCTCAGCACCTCAATGGTTCTGCAGCTTTCAATGGTGTAG
ACAATAGCGGGCTAGTCTCAGGAAACAGACCTGCACAAGTCCCTCCAGGCACCTGCCCAGTGGA
TCCTTTTGAGGCCCAGTGGGCTGCACTAGAAAGCAAGCCCAAGCAGCGCACCAACCCCTCTCCT
ACCAACCCTTTCTCCAGTGATGCACAGAAGGCATTTGAAATAGAGCTTTAG

hide sequence

RefSeq Acc Id:

XM_039111829 ⟹ XP_038967757

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,422 (-)	NCBI

RefSeq Acc Id:

XM_039111830 ⟹ XP_038967758

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,422 (-)	NCBI

RefSeq Acc Id:

XM_039111831 ⟹ XP_038967759

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,290 (-)	NCBI

RefSeq Acc Id:

XM_039111832 ⟹ XP_038967760

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,352 (-)	NCBI

RefSeq Acc Id:

XM_039111833 ⟹ XP_038967761

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,395 (-)	NCBI

RefSeq Acc Id:

XM_039111834 ⟹ XP_038967762

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,290 (-)	NCBI

RefSeq Acc Id:

XM_039111835 ⟹ XP_038967763

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,422 (-)	NCBI

RefSeq Acc Id:

XM_039111836 ⟹ XP_038967764

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,421 (-)	NCBI

RefSeq Acc Id:

XM_039111837 ⟹ XP_038967765

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,421 (-)	NCBI

RefSeq Acc Id:

XM_039111838 ⟹ XP_038967766

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,420 (-)	NCBI

RefSeq Acc Id:

XM_039111840 ⟹ XP_038967768

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,420 (-)	NCBI

RefSeq Acc Id:

XM_039111841 ⟹ XP_038967769

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	103,431,400 - 103,553,395 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001398882	(Get FASTA)	NCBI Sequence Viewer
	NP_001398883	(Get FASTA)	NCBI Sequence Viewer
	NP_001398884	(Get FASTA)	NCBI Sequence Viewer
	NP_001398885	(Get FASTA)	NCBI Sequence Viewer
	NP_579821	(Get FASTA)	NCBI Sequence Viewer
	XP_038967757	(Get FASTA)	NCBI Sequence Viewer
	XP_038967758	(Get FASTA)	NCBI Sequence Viewer
	XP_038967759	(Get FASTA)	NCBI Sequence Viewer
	XP_038967760	(Get FASTA)	NCBI Sequence Viewer
	XP_038967761	(Get FASTA)	NCBI Sequence Viewer
	XP_038967762	(Get FASTA)	NCBI Sequence Viewer
	XP_038967763	(Get FASTA)	NCBI Sequence Viewer
	XP_038967764	(Get FASTA)	NCBI Sequence Viewer
	XP_038967765	(Get FASTA)	NCBI Sequence Viewer
	XP_038967766	(Get FASTA)	NCBI Sequence Viewer
	XP_038967768	(Get FASTA)	NCBI Sequence Viewer
	XP_038967769	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66596	(Get FASTA)	NCBI Sequence Viewer
	AAL76088	(Get FASTA)	NCBI Sequence Viewer
	ABC69734	(Get FASTA)	NCBI Sequence Viewer
	ABC69735	(Get FASTA)	NCBI Sequence Viewer
	ABC69736	(Get FASTA)	NCBI Sequence Viewer
	ABC69737	(Get FASTA)	NCBI Sequence Viewer
	BAE45130	(Get FASTA)	NCBI Sequence Viewer
	Q2LC84	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_579821 ⟸ NM_133287

- UniProtKB:

Q2LC86 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKR
LKATGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRW
ICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQ
AEREEIMKQLQDAKKAETDKTVGPSVAPGNSAPSPSSPTSPTLDPTASLEMNNPHAIPRRHAPI
EQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNTVPEVEGEAESISSLCS
QITSAFSTPCEDPFSSAPMTKPVTLVAPQSPVLQGTEWGQSSGAASPGLFQAGHRRTPSEADRW
LEEVSKSVRAQQPQASAAPLQPVLQPPPPAAIAPPAPPFQGHAFLTSQPVPVGVVPPLQPAFVS
TQSYPVANGMPYPASNVPVVGITPSQMVANVFGTAGHPQATHPHQSPSLAKQQTFPQYETSSAT
TSPFFKPSAQHLNGSAAFNGVDNSGLVSGNRPAQVPPGTCPVDPFEAQWAALESKPKQRTNPSP
TNPFSSDAQKAFEIEL

hide sequence

RefSeq Acc Id:

ENSRNOP00000042586 ⟸ ENSRNOT00000042594

RefSeq Acc Id:

ENSRNOP00000048410 ⟸ ENSRNOT00000049481

RefSeq Acc Id:

ENSRNOP00000013026 ⟸ ENSRNOT00000013026

RefSeq Acc Id:	XP_038967758 ⟸ XM_039111830
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038967763 ⟸ XM_039111835
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038967757 ⟸ XM_039111829
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038967764 ⟸ XM_039111836
- Peptide Label:	isoform X2
- UniProtKB:	F1LRS4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967765 ⟸ XM_039111837
- Peptide Label:	isoform X3
- UniProtKB:	F1LNZ2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967768 ⟸ XM_039111840
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038967766 ⟸ XM_039111838
- Peptide Label:	isoform X4
- UniProtKB:	Q2LC86 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967769 ⟸ XM_039111841
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038967761 ⟸ XM_039111833
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038967760 ⟸ XM_039111832
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038967762 ⟸ XM_039111834
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038967759 ⟸ XM_039111831
- Peptide Label:	isoform X1

Protein Domains

PID

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q2LC84-F1-model_v2	AlphaFold	Q2LC84	1-652	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620107	AgrOrtholog
BioCyc Gene	G2FUF-36850	BioCyc
Ensembl Genes	ENSRNOG00000009653	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000013026	ENTREZGENE
	ENSRNOP00000013026.7	UniProtKB/TrEMBL
	ENSRNOP00000042586	ENTREZGENE
	ENSRNOP00000042586.5	UniProtKB/TrEMBL
	ENSRNOP00000048410	ENTREZGENE
	ENSRNOP00000048410.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013026	ENTREZGENE
	ENSRNOT00000013026.7	UniProtKB/TrEMBL
	ENSRNOT00000042594	ENTREZGENE
	ENSRNOT00000042594.6	UniProtKB/TrEMBL
	ENSRNOT00000049481	ENTREZGENE
	ENSRNOT00000049481.6	UniProtKB/TrEMBL
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7934724	IMAGE-MGC_LOAD
InterPro	Numb/numb-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Numb_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTB/PI_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29419	UniProtKB/TrEMBL
MGC_CLONE	MGC:188364	IMAGE-MGC_LOAD
NCBI Gene	29419	ENTREZGENE
PANTHER	PROTEIN NUMB HOMOLOG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR47368	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	NumbF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PID	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Numb	PhenoGen
PIRSF	Numb/numb-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	PID	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PTB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	F1LNZ2	ENTREZGENE
	F1LRS4	ENTREZGENE
	H9KVE4_RAT	UniProtKB/TrEMBL
	NUMB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q2LC85_RAT	UniProtKB/TrEMBL
	Q2LC86	ENTREZGENE, UniProtKB/TrEMBL
	Q2LC87_RAT	UniProtKB/TrEMBL
	Q3MUI1_RAT	UniProtKB/TrEMBL
UniProt Secondary	B2GVA9	UniProtKB/Swiss-Prot
	F1LNZ2	UniProtKB/TrEMBL
	F1LRS4	UniProtKB/TrEMBL
	F1MAI8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-04	Numb	NUMB, endocytic adaptor protein	Numb	numb homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-17	Numb	numb homolog (Drosophila)	Numb	numb gene homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Numb	numb gene homolog (Drosophila)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Numb	numb gene homolog (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_transcript	multiple alternative splice variants exist in the developing and adult retina	724390

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)