Mpst (mercaptopyruvate sulfurtransferase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mpst (mercaptopyruvate sulfurtransferase) Rattus norvegicus

Analyze

Symbol:

Mpst

Name:

mercaptopyruvate sulfurtransferase

RGD ID:

620065

Description:

Enables identical protein binding activity and thiosulfate sulfurtransferase activity. Involved in several processes, including liver development; spinal cord development; and transsulfuration. Located in mitochondrion. Biomarker of type 2 diabetes mellitus. Orthologous to human MPST (mercaptopyruvate sulfurtransferase); PARTICIPATES IN cysteine metabolic pathway; mercaptolactate-cysteine disulfiduria pathway; ocular nonnephropathic cystinosis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

3-mercaptopyruvate sulfurtransferase; Mst

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MPST (mercaptopyruvate sulfurtransferase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Mpst (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mpst (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MPST (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MPST (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mpst (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MPST (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MPST (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mpst (mercaptopyruvate sulfurtransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TST (thiosulfate sulfurtransferase)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Mpst (mercaptopyruvate sulfurtransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MPST (mercaptopyruvate sulfurtransferase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:162544	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TUM1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mpst-7	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	mpst	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	109,955,581 - 109,963,155 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	109,955,675 - 109,963,141 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	111,705,344 - 111,712,997 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	113,928,877 - 113,936,530 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	113,897,575 - 113,905,031 (+)	NCBI	Rnor_WKY
Rnor_6.0	7	119,626,636 - 119,631,317 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	119,626,637 - 119,631,425 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	119,617,311 - 119,621,992 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	116,359,466 - 116,364,146 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	116,393,694 - 116,398,377 (+)	NCBI
Celera	7	106,296,353 - 106,301,034 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

genetic disease (ISO)

melanoma (ISO)

myoclonic dystonia 26 (ISO)

neurodegeneration with brain iron accumulation 2A (ISO)

type 2 diabetes mellitus (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

acrylonitrile (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

AICA ribonucleotide (EXP)

aldehydo-D-glucose (EXP)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

carmustine (ISO)

cefaloridine (EXP)

choline (ISO)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

D-glucose (EXP)

decabromodiphenyl ether (ISO)

diazinon (EXP)

dibutyl phthalate (EXP)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

fructose (EXP)

furan (EXP)

gentamycin (EXP)

glucose (EXP)

hexachlorobenzene (EXP)

hydralazine (ISO)

hydrogen cyanide (ISO)

irinotecan (ISO)

ivermectin (ISO)

L-methionine (ISO)

mercury dichloride (EXP)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium cyanide (ISO)

resveratrol (EXP,ISO)

rotenone (ISO)

selenium atom (ISO)

senecionine (ISO)

sodium arsenite (EXP)

T-2 toxin (EXP)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

topotecan (EXP)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zinc atom (EXP)

zinc sulfate (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

hydrogen sulfide biosynthetic process (ISO,ISS)

kidney development (IDA)

liver development (IDA)

spinal cord development (IEP)

transsulfuration (IDA)

Cellular Component

cytoplasm (IDA)

mitochondrion (IBA,IDA)

neuron projection (ISO,ISS)

synapse (IEA)

Molecular Function

3-mercaptopyruvate sulfurtransferase activity (ISO)

identical protein binding (IDA)

protein binding (ISO)

thiosulfate sulfurtransferase activity (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

cysteine and methionine metabolic pathway (IEA)

cysteine metabolic pathway (ISO)

mercaptolactate-cysteine disulfiduria pathway (ISO)

ocular nonnephropathic cystinosis pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Developmental pattern, tissue distribution, and subcellular distribution of cysteine: alpha-ketoglutarate aminotransferase and 3-mercaptopyruvate sulfurtransferase activities in the rat.	Kuo SM, etal., Biol Neonate. 1983;43(1-2):23-32.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons.	Miyamoto R, etal., J Neurochem. 2014 Jul;130(1):29-40. doi: 10.1111/jnc.12698. Epub 2014 Mar 27.
6.	Proteomic profiling of non-obese type 2 diabetic skeletal muscle.	Mullen E and Ohlendieck K, Int J Mol Med. 2010 Mar;25(3):445-58.
7.	Role of amino acid residues in the active site of rat liver mercaptopyruvate sulfurtransferase. CDNA cloning, overexpression, and site-directed mutagenesis.	Nagahara N and Nishino T, J Biol Chem 1996 Nov 1;271(44):27395-401.
8.	Tissue and subcellular distribution of mercaptopyruvate sulfurtransferase in the rat: confocal laser fluorescence and immunoelectron microscopic studies combined with biochemical analysis.	Nagahara N, etal., Histochem Cell Biol. 1998 Sep;110(3):243-50.
9.	Cytosolic mercaptopyruvate sulfurtransferase is evolutionarily related to mitochondrial rhodanese. Striking similarity in active site amino acid sequence and the increase in the mercaptopyruvate sulfurtransferase activity of rhodanese by site-directed mutagenesis.	Nagahara N, etal., J Biol Chem. 1995 Jul 7;270(27):16230-5.
10.	Thioredoxin-dependent enzymatic activation of mercaptopyruvate sulfurtransferase. An intersubunit disulfide bond serves as a redox switch for activation.	Nagahara N, etal., J Biol Chem. 2007 Jan 19;282(3):1561-9. Epub 2006 Nov 27.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Regulation of myelin oligodendrocyte glycoprotein in different species throughout development.	Slavin AJ, etal., Dev Neurosci. 1997;19(1):69-78.

Additional References at PubMed

PMID:12477932	PMID:12865426	PMID:14651853	PMID:15489334	PMID:16107337	PMID:18614015	PMID:18855522	PMID:19056867	PMID:19605461	PMID:22149235	PMID:23104984	PMID:23376485
PMID:23533145	PMID:23759691	PMID:23805308	PMID:24051007	PMID:26519030	PMID:28079151	PMID:29331374	PMID:31893496	PMID:32813542

Genomics

Comparative Map Data

Mpst
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	109,955,581 - 109,963,155 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	109,955,675 - 109,963,141 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	111,705,344 - 111,712,997 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	113,928,877 - 113,936,530 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	113,897,575 - 113,905,031 (+)	NCBI	Rnor_WKY
Rnor_6.0	7	119,626,636 - 119,631,317 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	119,626,637 - 119,631,425 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	119,617,311 - 119,621,992 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	116,359,466 - 116,364,146 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	116,393,694 - 116,398,377 (+)	NCBI
Celera	7	106,296,353 - 106,301,034 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

MPST
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	37,019,742 - 37,029,815 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	22	37,019,635 - 37,029,821 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	37,415,783 - 37,425,856 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	35,745,648 - 35,755,809 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	35,740,290 - 35,750,363	NCBI
Celera	22	21,217,038 - 21,227,199 (+)	NCBI		Celera
Cytogenetic Map	22	q12.3	NCBI
HuRef	22	20,380,914 - 20,391,094 (+)	NCBI		HuRef
CHM1_1	22	37,375,175 - 37,385,355 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	37,479,341 - 37,489,414 (+)	NCBI		T2T-CHM13v2.0

Mpst
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	78,290,918 - 78,298,213 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	78,290,616 - 78,298,213 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	78,406,712 - 78,414,015 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	78,406,416 - 78,414,013 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	78,237,142 - 78,244,445 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	78,234,359 - 78,241,268 (+)	NCBI		MGSCv36	mm8
Celera	15	79,869,406 - 79,876,711 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI

Mpst
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	23,538,648 - 23,547,120 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	23,538,648 - 23,543,132 (+)	NCBI	ChiLan1.0	ChiLan1.0

MPST
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	22	49,565,112 - 49,575,337 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	17,933,995 - 17,944,196 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	35,770,203 - 35,780,250 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	35,770,209 - 35,780,250 (+)	Ensembl	panpan1.1		panPan2

MPST
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	27,465,007 - 27,469,788 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	27,443,865 - 27,469,554 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	27,419,572 - 27,427,730 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	28,257,080 - 28,265,242 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	28,254,100 - 28,265,176 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	27,978,667 - 27,986,827 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	28,287,244 - 28,295,406 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	28,465,170 - 28,473,346 (-)	NCBI		UU_Cfam_GSD_1.0

Mpst
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	10,862,881 - 10,866,510 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	3,873,176 - 3,876,706 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936492	3,873,295 - 3,876,895 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MPST
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	10,739,197 - 10,749,731 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	10,739,179 - 10,749,826 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	8,338,529 - 8,345,210 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MPST
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	19,724,780 - 19,735,503 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	19,724,809 - 19,735,194 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	106,127,100 - 106,137,854 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mpst
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	10,756,634 - 10,764,936 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	10,756,634 - 10,764,950 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mpst
49 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	50
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000000201
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat

Markers in Region

RH133346

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	109,962,874 - 109,963,081 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	119,631,148 - 119,631,354	NCBI	Rnor6.0
Rnor_5.0	7	119,621,823 - 119,622,029	UniSTS	Rnor5.0
RGSC_v3.4	7	116,363,978 - 116,364,184	UniSTS	RGSC3.4
Celera	7	106,300,865 - 106,301,071	UniSTS
RH 3.4 Map	7	813.1	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	36	11	8
Low											5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC086575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D50564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215688	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000000201 ⟹ ENSRNOP00000000201

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	109,955,675 - 109,963,141 (+)	Ensembl
Rnor_6.0 Ensembl	7	119,626,637 - 119,631,425 (+)	Ensembl

RefSeq Acc Id:

NM_138843 ⟹ NP_620198

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	109,955,697 - 109,963,155 (+)	NCBI
Rnor_6.0	7	119,626,636 - 119,631,317 (+)	NCBI
Rnor_5.0	7	119,617,311 - 119,621,992 (+)	NCBI
RGSC_v3.4	7	116,359,466 - 116,364,146 (+)	RGD
Celera	7	106,296,353 - 106,301,034 (+)	NCBI

Sequence:

show sequence

GAATTCCGTCTGGCCTCCTTCCCTCCCCTGGGTACCCTCTTACTGTCTGCCACCTCTCGGCTAC
CTCCACTGAGTGCCCAGGAGTCACTGAAACTCCTGGTCTCTGGGATATCACCTTAAACACCACC
TGAGTTGTCTGAGGAAGGACTCTTGGCAAAGCAGGGTCAGAGTGACTTTGCTGGCCCTGCAATC
CGAGCGTCCCCTAGGCCATGGCTGCCCCACAGCTTTTCCGAGCTCTGGTATCTGCTCAGTGGGT
GGCGGAGGCTCTGAAATCCCCTCGCGCCTCTCAGCCGCTGAAGTTACTGGATGCGTCCTGGTAC
CTACCCAAGCTGGGCCGCGATGCGCGACGCGAGTTTGAGGAGCGCCACATCCCGGGCGCCGCCT
TCTTTGACATCGATCGTTGCAGCGACCACACATCGCCCTACGACCACATGCTGCCTAGTGCCAC
GCATTTCGCCGACTACGCGGGCAGCTTGGGCGTGAGTGCCGCTACACACGTCGTGATCTACGAC
GGCAGCGACCAGGGCCTCTATTCCGCTCCGAGGGTCTGGTGGATGTTCCGCGCCTTCGGCCACC
ACTCTGTGTCGTTGCTGGACGGCGGCTTCCGCTATTGGCTGAGCCAGAACCTGCCAATTAGCTC
TGGCAAAAGCCCCTCGGAACCTGCGGAGTTCTGCGCGCAGCTCGATCCCTCCTTCATCAAGACC
CACGAGGATATCCTGGAGAACTTGGATGCCCGGCGCTTCCAGGTAGTGGACGCCCGCGCAGCTG
GCCGTTTCCAAGGCACACAGCCAGAACCCCGAGATGGCATCGAACCTGGACACATCCCTGGCTC
AGTAAACATCCCATTCACTGAATTCCTGACCAGTGAAGGTCTGGAGAAGAGCCCAGAGGAGATC
CAACGCCTGTTCCAGGAGAAGAAGGTGGACCTGTCCAAGCCCTTGGTAGCCACATGCGGCTCCG
GTGTCACAGCCTGCCACGTGGTCCTGGGGGCCTTCCTCTGTGGCAAACCCGATGTGCCTGTCTA
CGATGGCTCCTGGGTGGAGTGGTACATGCGTGCCCAACCGGAGCACGTCATCTCTCAGGGCCGG
GGGAAGACCCTGTGAAGGACACAGTGCAGCTTGGGTGACACCGAACCATCCTAGTGCCAGCCTG
GTCACTCTGACCCTGCTTTGCCAAGAGTCCTTCCTCAGACAACTCAGGTGGTGTTTAAGGTGAT
ATCCCAGAGACCAGGAGTTTCAGTGACTCCTGGGCACTCAGTGGAGGTAGCCGAGAGGTGGCAG
ACAGTAAGAGGGCTGCCGGAATTC

hide sequence

RefSeq Acc Id:

XM_039078360 ⟹ XP_038934288

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	109,955,581 - 109,963,151 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_620198	(Get FASTA)	NCBI Sequence Viewer
	XP_038934288	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86575	(Get FASTA)	NCBI Sequence Viewer
	BAA09127	(Get FASTA)	NCBI Sequence Viewer
	EDM15873	(Get FASTA)	NCBI Sequence Viewer
	P97532	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_620198 ⟸ NM_138843

- UniProtKB:

P97532 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAAPQLFRALVSAQWVAEALKSPRASQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDR
CSDHTSPYDHMLPSATHFADYAGSLGVSAATHVVIYDGSDQGLYSAPRVWWMFRAFGHHSVSLL
DGGFRYWLSQNLPISSGKSPSEPAEFCAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGT
QPEPRDGIEPGHIPGSVNIPFTEFLTSEGLEKSPEEIQRLFQEKKVDLSKPLVATCGSGVTACH
VVLGAFLCGKPDVPVYDGSWVEWYMRAQPEHVISQGRGKTL

hide sequence

RefSeq Acc Id:

ENSRNOP00000000201 ⟸ ENSRNOT00000000201

RefSeq Acc Id:	XP_038934288 ⟸ XM_039078360
- Peptide Label:	isoform X1

Protein Domains

Rhodanese

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97532-F1-model_v2	AlphaFold	P97532	1-297	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695460

Promoter ID:

EPDNEW_R5985

Type:

initiation region

Name:

Mpst_1

Description:

mercaptopyruvate sulfurtransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	119,626,620 - 119,626,680	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620065	AgrOrtholog
BioCyc Gene	G2FUF-32827	BioCyc
BioCyc Pathway	PWY-5329 [L-cysteine degradation III]	BioCyc
Ensembl Genes	ENSRNOG00000000185	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000000201	ENTREZGENE
	ENSRNOP00000000201.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000201	ENTREZGENE
	ENSRNOT00000000201.6	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.250.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7306783	IMAGE-MGC_LOAD
InterPro	Rhodanese-like_dom	UniProtKB/Swiss-Prot
	Rhodanese-like_dom_sf	UniProtKB/Swiss-Prot
	Thiosulphate_STrfase_CS	UniProtKB/Swiss-Prot
	TST/MPST-like	UniProtKB/Swiss-Prot
KEGG Report	rno:192172	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105317	IMAGE-MGC_LOAD
NCBI Gene	192172	ENTREZGENE
PANTHER	3-MERCAPTOPYRUVATE SULFURTRANSFERASE	UniProtKB/Swiss-Prot
	PTHR11364	UniProtKB/Swiss-Prot
Pfam	Rhodanese	UniProtKB/Swiss-Prot
PhenoGen	Mpst	PhenoGen
PROSITE	RHODANESE_1	UniProtKB/Swiss-Prot
	RHODANESE_2	UniProtKB/Swiss-Prot
	RHODANESE_3	UniProtKB/Swiss-Prot
SMART	RHOD	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52821	UniProtKB/Swiss-Prot
UniProt	P97532	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-08-06	Mpst	mercaptopyruvate sulfurtransferase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	296 amino acid residues	729064
gene_protein	Arg187 and Arg196 are important residues in determining substrate specificity for mercaptopyruvate	729064

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)