Slc31a1 (solute carrier family 31 member 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc31a1 (solute carrier family 31 member 1) Rattus norvegicus

Analyze

Symbol:

Slc31a1

Name:

solute carrier family 31 member 1

RGD ID:

620059

Description:

Enables copper ion transmembrane transporter activity. Involved in cellular response to cisplatin; copper ion import; and copper ion import across plasma membrane. Located in apical plasma membrane and neuronal cell body. Orthologous to human SLC31A1 (solute carrier family 31 member 1); PARTICIPATES IN cisplatin drug pathway; cisplatin response pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

copper transporter 1; Copper uptake transporter 1; Ctr1; high affinity copper uptake protein 1; liver regeneration-related protein LRRGT00200; LRRGT00200; rCTR1; solute carrier family 31 (copper transporter), member 1; solute carrier family 31 (copper transporters), member 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC31A1 (solute carrier family 31 member 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slc31a1 (solute carrier family 31, member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc31a1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC31A1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC31A1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc31a1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC31A1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC31A1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc31a1 (solute carrier family 31 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CHD2 (chromodomain helicase DNA binding protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SLC31A1 (solute carrier family 31 member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc31a1 (solute carrier family 31, member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc31a1 (solute carrier family 31 member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CTR2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ctr1A	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F27C1.2	Alliance	DIOPT (Hieranoid\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	F31E8.4	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	CTR3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	75,814,744 - 75,844,241 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	75,814,743 - 75,844,228 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	78,214,842 - 78,241,772 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	80,031,936 - 80,058,869 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	80,007,446 - 80,034,378 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	78,222,504 - 78,249,358 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	78,222,504 - 78,249,358 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	82,341,969 - 82,371,285 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	79,359,420 - 79,385,988 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	79,364,532 - 79,391,101 (+)	NCBI
Celera	5	74,756,941 - 74,783,647 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amyotrophic lateral sclerosis (ISO)

Congenital Abnormalities (ISO)

Embryo Loss (ISO)

Experimental Liver Neoplasms (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Manganese Poisoning (ISO)

Necrosis (ISO)

NEURODEGENERATION AND SEIZURES DUE TO COPPER TRANSPORT DEFECT (ISO)

Prostatic Neoplasms (ISO)

pulmonary hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2,2-tetramine (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-Iodothyronamine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiloride (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

bathocuproine disulfonic acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carboplatin (EXP,ISO)

casticin (ISO)

celecoxib (ISO)

chlorpromazine (ISO)

chromium(6+) (ISO)

cisplatin (EXP,ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

CU-O LINKAGE (ISO)

Cuprizon (EXP)

cytochalasin D (ISO)

D-penicillamine (ISO)

diazinon (ISO)

diethylstilbestrol (EXP)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

fructose (EXP)

fumonisin B1 (ISO)

genistein (ISO)

gentamycin (EXP)

glutathione (ISO)

graphite (EXP)

hydrogen peroxide (ISO)

irinotecan (EXP)

isotretinoin (ISO)

ivermectin (ISO)

lactacystin (ISO)

lamivudine (ISO)

lead diacetate (EXP,ISO)

lead(0) (EXP)

lipopolysaccharide (ISO)

lovastatin (EXP)

manganese(II) chloride (EXP)

methapyrilene (EXP)

methyl beta-cyclodextrin (ISO)

methyl methanesulfonate (ISO)

Methylazoxymethanol acetate (EXP)

methylmercury chloride (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

nitrofen (EXP)

oxaliplatin (EXP,ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

platinum (ISO)

platinum(0) (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

SB 431542 (ISO)

silver atom (EXP)

silver(0) (EXP)

silver(1+) nitrate (ISO)

sodium dichromate (EXP)

streptozocin (EXP)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

tetrathiomolybdate(2-) (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

Y-27632 (ISO)

zearalenone (ISO)

zidovudine (ISO)

zinc acetate (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IEA,ISO,ISS)

cellular response to cisplatin (IDA)

copper ion import (IDA,IEA,ISO)

copper ion import across plasma membrane (IMP)

copper ion transmembrane transport (IEA)

copper ion transport (ISO)

establishment of localization in cell (IEA,ISO)

intracellular copper ion homeostasis (IEA,ISO)

plasma membrane copper ion transport (IEA,ISO,ISS)

protein complex oligomerization (IEA,ISO,ISS)

silver ion transmembrane transport (IEA,ISO,ISS)

transmembrane transport (IDA)

vascular endothelial growth factor receptor-2 signaling pathway (IEA,ISO,ISS)

xenobiotic transport (IEA,ISO,ISS)

Cellular Component

apical plasma membrane (IDA,IEA,ISO)

basolateral plasma membrane (IEA,ISO,ISS)

early endosome membrane (IEA,ISO,ISS)

intercalated disc (IEA,ISO)

late endosome (ISO)

late endosome membrane (IEA)

neuronal cell body (IDA)

plasma membrane (ISO)

recycling endosome (ISO)

recycling endosome membrane (IEA,ISO,ISS)

Molecular Function

copper ion binding (IEA,ISO,ISS)

copper ion transmembrane transporter activity (IDA,IEA,ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

silver ion transmembrane transporter activity (IEA,ISO,ISS)

xenobiotic transmembrane transporter activity (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

cisplatin drug pathway (IDA,ISO)

cisplatin response pathway (IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Membrane transporters as mediators of Cisplatin effects and side effects.	Ciarimboli G Scientifica (Cairo). 2012;2012:473829. doi: 10.6064/2012/473829. Epub 2012 Nov 25.
2.	Iron deficiency in the pregnant rat has differential effects on maternal and fetal copper levels.	Gambling L, etal., J Nutr Biochem 2004 Jun;15(6):366-72.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	The N-terminus of the human copper transporter 1 (hCTR1) is localized extracellularly, and interacts with itself.	Klomp AE, etal., Biochem J 2003 Mar 15;370(Pt 3):881-9.
6.	Contributions of rat Ctr1 to the uptake and toxicity of copper and platinum anticancer drugs in dorsal root ganglion neurons.	Liu JJ, etal., Biochem Pharmacol. 2013 Jan 15;85(2):207-15. doi: 10.1016/j.bcp.2012.10.023. Epub 2012 Nov 1.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Mechanism of copper transport at the blood-cerebrospinal fluid barrier: influence of iron deficiency in an in vitro model.	Monnot AD, etal., Exp Biol Med (Maywood). 2012 Mar;237(3):327-33. doi: 10.1258/ebm.2011.011170.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	Ctr1 is an apical copper transporter in mammalian intestinal epithelial cells in vivo that is controlled at the level of protein stability.	Nose Y, etal., J Biol Chem. 2010 Oct 15;285(42):32385-92. doi: 10.1074/jbc.M110.143826. Epub 2010 Aug 10.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Subcellular targets of cisplatin cytotoxicity: an integrated view.	Sancho-Martinez SM, etal., Pharmacol Ther. 2012 Oct;136(1):35-55. doi: 10.1016/j.pharmthera.2012.07.003. Epub 2012 Jul 14.
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	Dysregulation of intracellular copper trafficking pathway in a mouse model of mutant copper/zinc superoxide dismutase-linked familial amyotrophic lateral sclerosis.	Tokuda E, etal., J Neurochem. 2009 Oct;111(1):181-91. doi: 10.1111/j.1471-4159.2009.06310.x. Epub 2009 Jul 27.

Additional References at PubMed

PMID:12177073	PMID:15489334	PMID:16501047	PMID:16637264	PMID:16741141	PMID:19240214	PMID:20004225	PMID:20836889	PMID:22465424	PMID:24167251	PMID:24316150

Genomics

Comparative Map Data

Slc31a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	75,814,744 - 75,844,241 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	75,814,743 - 75,844,228 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	78,214,842 - 78,241,772 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	80,031,936 - 80,058,869 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	80,007,446 - 80,034,378 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	78,222,504 - 78,249,358 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	78,222,504 - 78,249,358 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	82,341,969 - 82,371,285 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	79,359,420 - 79,385,988 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	79,364,532 - 79,391,101 (+)	NCBI
Celera	5	74,756,941 - 74,783,647 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

SLC31A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	113,221,544 - 113,264,492 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	113,221,544 - 113,264,492 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	115,983,824 - 116,026,772 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	115,023,689 - 115,066,593 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	113,063,421 - 113,106,325	NCBI
Celera	9	86,631,426 - 86,674,386 (+)	NCBI		Celera
Cytogenetic Map	9	q32	ENTREZGENE
HuRef	9	85,591,243 - 85,634,236 (+)	NCBI		HuRef
CHM1_1	9	116,130,594 - 116,173,508 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	125,420,370 - 125,463,332 (+)	NCBI		T2T-CHM13v2.0

Slc31a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	62,278,821 - 62,310,006 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	62,278,964 - 62,310,006 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	62,360,583 - 62,391,769 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	62,360,727 - 62,391,769 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	62,021,735 - 62,052,803 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	61,847,110 - 61,878,123 (+)	NCBI		MGSCv36	mm8
Celera	4	61,032,896 - 61,063,964 (+)	NCBI		Celera
Cytogenetic Map	4	B3	NCBI
cM Map	4	33.11	NCBI

Slc31a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	14,220,495 - 14,264,699 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	14,221,258 - 14,264,288 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC31A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	26,115,835 - 26,158,851 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	84,319,304 - 84,362,288 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	112,691,503 - 112,734,352 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	112,691,503 - 112,734,352 (+)	Ensembl	panpan1.1		panPan2

SLC31A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	67,590,087 - 67,628,947 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	67,591,080 - 67,625,798 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	65,994,878 - 66,033,741 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	68,714,951 - 68,753,806 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	68,715,210 - 68,812,959 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	67,232,618 - 67,271,432 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	67,254,684 - 67,293,582 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	68,000,439 - 68,039,329 (+)	NCBI		UU_Cfam_GSD_1.0

Slc31a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	182,901,798 - 182,934,079 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936559	331,917 - 364,852 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936559	333,461 - 364,737 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC31A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	253,868,332 - 253,894,449 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	253,868,389 - 253,893,135 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	284,727,786 - 284,753,055 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	1	q28-q2.13	NCBI

SLC31A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	26,307,308 - 26,348,701 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	26,311,334 - 26,348,694 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	16,453,718 - 16,495,422 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc31a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	21,832,908 - 21,849,576 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	21,832,924 - 21,879,089 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc31a1
74 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	63
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000019544
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat

Markers in Region

RH129201

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	75,841,763 - 75,841,976 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	78,249,080 - 78,249,292	NCBI	Rnor6.0
Rnor_5.0	5	82,368,812 - 82,369,024	UniSTS	Rnor5.0
RGSC_v3.4	5	79,385,710 - 79,385,922	UniSTS	RGSC3.4
Celera	5	74,783,369 - 74,783,581	UniSTS
RH 3.4 Map	5	559.0	UniSTS
Cytogenetic Map	5	q24	UniSTS

RH133724

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	75,822,418 - 75,823,125 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	78,229,663 - 78,230,369	NCBI	Rnor6.0
Rnor_5.0	5	82,349,514 - 82,350,220	UniSTS	Rnor5.0
RGSC_v3.4	5	79,366,579 - 79,367,285	UniSTS	RGSC3.4
Celera	5	74,764,120 - 74,764,826	UniSTS
RH 3.4 Map	5	558.4	UniSTS
Cytogenetic Map	5	q24	UniSTS

RH128029

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	75,841,747 - 75,841,937 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	78,249,064 - 78,249,253	NCBI	Rnor6.0
Rnor_5.0	5	82,368,796 - 82,368,985	UniSTS	Rnor5.0
RGSC_v3.4	5	79,385,694 - 79,385,883	UniSTS	RGSC3.4
Celera	5	74,783,353 - 74,783,542	UniSTS
RH 3.4 Map	5	559.9	UniSTS
Cytogenetic Map	5	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	31	57	41	19	41	2	2	74	35	41	11	2
Low		12					6	9					6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF268030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY539951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000019544 ⟹ ENSRNOP00000019544

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	75,814,743 - 75,840,470 (+)	Ensembl
Rnor_6.0 Ensembl	5	78,222,504 - 78,249,358 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000114775 ⟹ ENSRNOP00000096861

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	75,815,254 - 75,844,228 (+)	Ensembl

RefSeq Acc Id:

NM_133600 ⟹ NP_598284

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	75,815,258 - 75,842,042 (+)	NCBI
Rnor_6.0	5	78,222,504 - 78,249,358 (+)	NCBI
Rnor_5.0	5	82,341,969 - 82,371,285 (+)	NCBI
RGSC_v3.4	5	79,359,420 - 79,385,988 (+)	RGD
Celera	5	74,756,941 - 74,783,647 (+)	RGD

Sequence:

show sequence

CGGTCCTGGGACACGTCGAGCCGGGCAGTAGTTGCGGGGGCTTGGGAGAAGTCCAGACCTGGTT
AGGGATCCAGTTCTGAGAGGAAGACTCAGGCGGTGGGGCTTGCCCTGGGAAGACCTTTGCGCTG
ACTCTCATCTTTTTCTGGAAAACTGGATCCTTCGGACCACATGAGGATGAACCACATGGAGATG
CATCATATGGGGATGAACCACACGGACGACAACATCACCATGCCACCCCACCAGCACCCCACCA
CCTCGGCCTCACACTCCCACGAGATGATGATGCCTATGACCTTCTACTTTGGCTTTAAGAATGT
GGACCTATTGTTTTCCAGTTTGGTAATCAACACACCTGGAGAAATGGCTGGAGCTTTTGTGGCA
GTGTTTTTACTAGCAATGTTTTATGAAGGACTCAAGATAGCCCGAGAGGGTCTGCTTCGAAAGT
CTCAAGTCAGCATTCGCTACAATTCCATGCCTGTGCCAGGACCAAATGGAACCATCCTTATGGA
GACACACAAAACTGTTGGGCAGCAGATGCTGAGCTTCCCCCACCTCCTGCAGACAGTGCTGCAC
ATCATCCAAGTAGTCATCAGCTACTTCCTCATGCTCATCTTCATGACCTACAATGGGTACCTAT
GCATTGCAGTAGCCGCAGGGGCTGGGACAGGATACTTTCTCTTCAGCTGGAAGAAGGCTGTGGT
GGTGGACATCACAGAGCACTGCCATTAACGTTAGACTCCACAGACAGGCCTTATTAATTGCTGT
AGGAAGCATCTTGGGACTGGAAGATATGATTCCCTCTCCAATCATCCCTCCTCTCTCCTGTCTC
TTTATACACACACACCTACTGAATAGAGGTCTAGCTGACAGTCTCTGAGTAGTGGTTTTTCTAA
TAAGATGAAATTGACTTTTCTCTTGAAAGTCACCTGTGAGATGTCTTCTCCCTCATCATCCTGA
GCCTTGTCTAATCCAGGTAGCTTCCTAGTTAATGATTTGGTTATCTGCTTCTTTCTACTTTTCC
AGGGTTTTTTTTTTTTTGGGGGGGGGGTGCATTTTTGTTTTAAACAGATACTATGTGTATTTGG
TGGCTGGGGTTCTGGGTCAGTGATGGAACAGGATTGATGGCAATTAGGGACATCTCATCCAGTC
GGGACTTAAATTTCACACTAGAAAATAATCTCCAGTCTTAGCACAGTGTGGGAAACACAGGTGC
CTCTCCAGACCTAGTGCACTTACGCCGAAACCCGAGTAGTGTGTGGGGCAGACAGGGACTAAAC
GCAGGCCGAGTTTCCCGCCCCCTCATCTACTTGTGTTCCTTACTTAACATTTTGATTAGAATGA
ACCTGCCCATCCCAACAAAAACAGGACAATCAATTTAAGACAACAGGAATAGATTGTTAAATAA
AACCCTTAGTATTTG

hide sequence

RefSeq Acc Id:

XM_039109221 ⟹ XP_038965149

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	75,815,236 - 75,844,241 (+)	NCBI

RefSeq Acc Id:

XM_039109222 ⟹ XP_038965150

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	75,814,744 - 75,844,241 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_598284	(Get FASTA)	NCBI Sequence Viewer
	XP_038965149	(Get FASTA)	NCBI Sequence Viewer
	XP_038965150	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF72546	(Get FASTA)	NCBI Sequence Viewer
	AAH78745	(Get FASTA)	NCBI Sequence Viewer
	AAS66291	(Get FASTA)	NCBI Sequence Viewer
	EDM10567	(Get FASTA)	NCBI Sequence Viewer
	Q9JK41	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598284 ⟸ NM_133600
- UniProtKB:	Q53YN6 (UniProtKB/Swiss-Prot), Q9JK41 (UniProtKB/Swiss-Prot), A6J7U0 (UniProtKB/TrEMBL), A0A8I6AQ78 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVINTPG EMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFP HLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH hide sequence

RefSeq Acc Id:

ENSRNOP00000019544 ⟸ ENSRNOT00000019544

RefSeq Acc Id:	XP_038965150 ⟸ XM_039109222
- Peptide Label:	isoform X1
- UniProtKB:	Q9JK41 (UniProtKB/Swiss-Prot), Q53YN6 (UniProtKB/Swiss-Prot), A6J7U0 (UniProtKB/TrEMBL), A0A8I6AQ78 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965149 ⟸ XM_039109221
- Peptide Label:	isoform X1
- UniProtKB:	Q9JK41 (UniProtKB/Swiss-Prot), Q53YN6 (UniProtKB/Swiss-Prot), A6J7U0 (UniProtKB/TrEMBL), A0A8I6AQ78 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000096861 ⟸ ENSRNOT00000114775

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JK41-F1-model_v2	AlphaFold	Q9JK41	1-187	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620059	AgrOrtholog
BioCyc Gene	G2FUF-41100	BioCyc
Ensembl Genes	ENSRNOG00000014475	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000019544.3	UniProtKB/TrEMBL
	ENSRNOP00000096861	ENTREZGENE
	ENSRNOP00000096861.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019544.5	UniProtKB/TrEMBL
	ENSRNOT00000114775	ENTREZGENE
	ENSRNOT00000114775.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7126088	IMAGE-MGC_LOAD
InterPro	Cop_transporter	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171135	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93210	IMAGE-MGC_LOAD
NCBI Gene	171135	ENTREZGENE
PANTHER	HIGH AFFINITY COPPER UPTAKE PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12483	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ctr	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc31a1	PhenoGen
UniProt	A0A8I6AQ78	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QA41_RAT	UniProtKB/TrEMBL
	A6J7U0	ENTREZGENE, UniProtKB/TrEMBL
	COPT1_RAT	UniProtKB/Swiss-Prot
	Q53YN6	ENTREZGENE
	Q9JK41	ENTREZGENE
UniProt Secondary	Q53YN6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc31a1	solute carrier family 31 member 1	Slc31a1	solute carrier family 31 (copper transporter), member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Slc31a1	solute carrier family 31 (copper transporter), member 1	Slc31a1	solute carrier family 31 (copper transporters), member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Slc31a1	solute carrier family 31 (copper transporters), member 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Slc31a1	solute carrier family 31 (copper transporters), member 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations