Advanced Search (OLGA)

Gene: Coro1a (coronin 1A) Rattus norvegicus

Analyze

Symbol:

Coro1a

Name:

coronin 1A

RGD ID:

620009

Description:

Predicted to enable cytoskeletal protein binding activity; phosphatidylinositol 3-kinase binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including natural killer cell degranulation; negative regulation of NF-kappaB transcription factor activity; and negative regulation of canonical NF-kappaB signal transduction. Predicted to act upstream of or within several processes, including early endosome to recycling endosome transport; nerve growth factor signaling pathway; and regulation of organelle organization. Predicted to be located in several cellular components, including actin cytoskeleton; cytoplasmic vesicle; and immunological synapse. Predicted to be part of protein-containing complex. Predicted to be active in glutamatergic synapse and stereocilium tip. Human ortholog(s) of this gene implicated in coronin-1A deficiency. Orthologous to human CORO1A (coronin 1A); PARTICIPATES IN phagocytosis pathway; tuberculosis pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

clipin-A; coronin, actin binding protein 1A; coronin-1A; coronin-like protein A; MGC93041; TACO; tryptophan aspartate-containing coat protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CORO1A (coronin 1A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Coro1a (coronin, actin binding protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Coro1a (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CORO1A (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CORO1A (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Coro1a (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CORO1A (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CORO1A (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Coro1a (coronin 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CORO1A (coronin 1A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Coro1a (coronin, actin binding protein 1A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	coro1a (coronin, actin binding protein, 1A)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CRN1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cor-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	coro	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	190,726,129 - 190,731,133 (-)	NCBI		GRCr8
mRatBN7.2	1	181,295,561 - 181,300,566 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	181,295,562 - 181,300,534 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	189,646,783 - 189,651,767 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	196,832,853 - 196,837,837 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	189,500,261 - 189,505,244 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	198,123,883 - 198,128,890 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	198,123,884 - 198,128,857 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	205,102,882 - 205,107,884 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	185,852,741 - 185,857,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	186,002,622 - 186,007,596 (-)	NCBI
Celera	1	178,953,035 - 178,958,009 (-)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

autism spectrum disorder (ISO)

autistic disorder (ISO)

carcinoma (ISO)

chromosome 16p11.2 deletion syndrome, 593-kb (ISO)

chromosome 16p11.2 duplication syndrome (ISO)

coronin-1A deficiency (ISO)

dilated cardiomyopathy (ISO)

Episodic Kinesigenic Dyskinesia (ISO)

episodic kinesigenic dyskinesia 1 (ISO)

genetic disease (ISO)

Glycogen Storage Disease XII (ISO)

schizophrenia (ISO)

severe combined immunodeficiency (ISO)

severe combined immunodeficiency 104 (ISS)

sick sinus syndrome (ISO)

sinoatrial node disease (ISO)

spondylocostal dysostosis 5 (ISO)

tuberculosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

7,12-dimethyltetraphene (EXP)

acetamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

butanal (ISO)

butyric acid (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

chenodeoxycholic acid (ISO)

chloroprene (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

deguelin (ISO)

deoxynivalenol (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dimethylarsinic acid (ISO)

dimethylselenide (ISO)

dioxygen (ISO)

diquat (ISO)

diuron (ISO)

dorsomorphin (ISO)

endosulfan (ISO)

ethanol (ISO)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

hydroxyl (ISO)

hypochlorous acid (ISO)

ivermectin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

methylseleninic acid (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

nickel atom (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

PhIP (EXP)

pirinixic acid (ISO)

resveratrol (EXP,ISO)

rotenone (ISO)

Rutecarpine (ISO)

sarin (EXP)

SB 431542 (ISO)

senecionine (ISO)

silicon dioxide (ISO)

simvastatin (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

Soman (EXP)

tamibarotene (ISO)

tamoxifen (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IEA,ISO)

actin filament organization (IBA,IEA,ISO)

biological_process (ND)

calcium ion transport (IEA,ISO)

cell migration (IBA)

cell-substrate adhesion (IEA,ISO)

cellular response to interleukin-4 (IEA,ISO)

early endosome to recycling endosome transport (IEA,ISO)

epithelial cell migration (IEA,ISO)

establishment of localization in cell (IEA,ISO)

homeostasis of number of cells within a tissue (IEA,ISO)

immunological synapse formation (ISO)

leukocyte chemotaxis (IEA,ISO)

natural killer cell degranulation (IEA,ISO)

negative regulation of actin nucleation (IEA,ISO)

negative regulation of canonical NF-kappaB signal transduction (ISO)

negative regulation of neuron apoptotic process (IEA,ISO)

negative regulation of NF-kappaB transcription factor activity (ISO)

negative regulation of vesicle fusion (IEA,ISO)

nerve growth factor signaling pathway (IEA,ISO)

neuron apoptotic process (IEA,ISO)

phagocytosis (IEA,ISO)

phagolysosome assembly (IEA,ISO)

positive chemotaxis (IEA,ISO)

positive regulation of T cell activation (IEA,ISO)

positive regulation of T cell migration (IEA,ISO)

positive regulation of T cell proliferation (IEA,ISO)

regulation of actin cytoskeleton organization (IEA,ISO)

regulation of actin filament polymerization (IEA,ISO)

regulation of actin polymerization or depolymerization (IEA,ISO)

regulation of cell shape (IEA,ISO)

regulation of release of sequestered calcium ion into cytosol (IEA,ISO)

response to cytokine (IEA,ISO)

T cell activation (IEA,ISO)

T cell differentiation (NAS)

T cell homeostasis (IEA,ISO)

T cell migration (IEA,ISO)

T cell proliferation (IEA,ISO)

thymocyte migration (IEA,ISO)

uropod organization (IEA,ISO)

vesicle fusion (IEA,ISO)

Cellular Component

actin cytoskeleton (IEA,ISO)

actin filament (IEA,ISO)

axon (IEA,ISO)

cell cortex (IEA)

cell leading edge (IEA,ISO)

cell-cell junction (IEA,ISO)

cortical actin cytoskeleton (IEA,ISO)

cytoplasm (IEA,ISO)

cytoplasmic vesicle (IEA)

cytoskeleton (IEA)

early endosome (IEA,ISO)

glutamatergic synapse (IEA,ISO)

immunological synapse (IEA,ISO)

lamellipodium (IEA,ISO)

membrane (IEA)

nucleus (ISO)

phagocytic cup (IEA,ISO)

phagocytic vesicle (IEA,ISO)

phagocytic vesicle membrane (IEA)

plasma membrane (IEA,ISO)

protein-containing complex (IEA,ISO)

stereocilium tip (ISO)

synapse (IEA,ISO)

Molecular Function

actin binding (IEA,ISO)

actin filament binding (IBA,IEA,ISO)

actin monomer binding (IEA,ISO)

cytoskeletal protein binding (IEA,ISO)

identical protein binding (IEA,ISO)

myosin heavy chain binding (IEA,ISO)

phosphatidylinositol 3-kinase binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

phagocytosis pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Coronin-1 expression in T lymphocytes: insights into protein function during T cell development and activation.	Nal B, etal., Int Immunol 2004 Feb;16(2):231-40.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	Direct interaction between p47phox and protein kinase C: evidence for targeting of protein kinase C by p47phox in neutrophils.	Reeves EP, etal., Biochem J 1999 Dec 15;344 Pt 3:859-66.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:7758584	PMID:9365277	PMID:9798653	PMID:11094157	PMID:12132654	PMID:12477932	PMID:15489334	PMID:15601263	PMID:15800061	PMID:16902139	PMID:17341475	PMID:17442961
PMID:17728463	PMID:18199416	PMID:18836449	PMID:19946888	PMID:20032464	PMID:20458337	PMID:22364218	PMID:22658674	PMID:23100250	PMID:23533145	PMID:23793062	PMID:24270184
PMID:24667537	PMID:24760828	PMID:25179994	PMID:25931508	PMID:26754646	PMID:26809475

Genomics

Comparative Map Data

Coro1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	190,726,129 - 190,731,133 (-)	NCBI		GRCr8
mRatBN7.2	1	181,295,561 - 181,300,566 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	181,295,562 - 181,300,534 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	189,646,783 - 189,651,767 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	196,832,853 - 196,837,837 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	189,500,261 - 189,505,244 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	198,123,883 - 198,128,890 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	198,123,884 - 198,128,857 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	205,102,882 - 205,107,884 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	185,852,741 - 185,857,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	186,002,622 - 186,007,596 (-)	NCBI
Celera	1	178,953,035 - 178,958,009 (-)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

CORO1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	30,183,602 - 30,189,076 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	30,182,827 - 30,189,076 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	30,194,923 - 30,200,397 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	30,102,427 - 30,107,898 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	30,102,448 - 30,107,898	NCBI
Celera	16	72,594,500 - 72,599,971 (-)	NCBI		Celera
Cytogenetic Map	16	p11.2	NCBI
HuRef	16	27,857,375 - 27,863,041 (+)	NCBI		HuRef
CHM1_1	16	31,409,355 - 31,415,021 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	30,468,184 - 30,473,658 (+)	NCBI		T2T-CHM13v2.0

Coro1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	126,298,946 - 126,303,925 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	126,298,945 - 126,306,959 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	126,699,774 - 126,704,816 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	126,699,773 - 126,707,787 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	133,843,288 - 133,848,268 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	126,490,922 - 126,495,902 (-)	NCBI		MGSCv36	mm8
Celera	7	126,547,074 - 126,552,054 (-)	NCBI		Celera
Cytogenetic Map	7	F3	NCBI
cM Map	7	69.25	NCBI

Coro1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	6,811,430 - 6,826,485 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955493	6,815,148 - 6,820,295 (-)	NCBI	ChiLan1.0	ChiLan1.0

CORO1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	30,926,030 - 30,931,532 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	35,294,286 - 35,299,847 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	16	30,549,880 - 30,555,093 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	30,550,383 - 30,556,196 (+)	Ensembl	panpan1.1		panPan2

CORO1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	18,161,850 - 18,167,915 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	18,160,601 - 18,167,818 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	19,740,842 - 19,746,439 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	18,298,321 - 18,303,918 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	18,298,356 - 18,303,915 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	18,097,136 - 18,102,732 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	18,012,545 - 18,018,141 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	18,328,371 - 18,333,968 (+)	NCBI		UU_Cfam_GSD_1.0

Coro1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	124,240,682 - 124,246,391 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	12,338,542 - 12,344,265 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	12,338,542 - 12,344,236 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CORO1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	18,336,898 - 18,342,396 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	18,336,813 - 18,342,381 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CORO1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	26,482,269 - 26,488,537 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	26,480,753 - 26,487,929 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	3,057,322 - 3,063,870 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Coro1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	13,105,153 - 13,111,357 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	13,106,416 - 13,111,394 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Coro1a
15 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	47
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000026496
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
61326	Eae6	Experimental allergic encephalomyelitis QTL 6	5.3		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	172949660	181830018	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
2325725	Eae31	Experimental allergic encephalomyelitis QTL 31			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	178810256	188377506	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383668	Rat

Markers in Region

Coro1a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	190,726,660 - 190,727,024 (+)	Marker Load Pipeline
mRatBN7.2	1	181,296,092 - 181,296,456 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	198,124,415 - 198,124,778	NCBI	Rnor6.0
Rnor_5.0	1	205,103,414 - 205,103,777	UniSTS	Rnor5.0
RGSC_v3.4	1	185,853,273 - 185,853,636	UniSTS	RGSC3.4
Celera	1	178,953,567 - 178,953,930	UniSTS
Cytogenetic Map	1	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130411	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF416730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF495469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026496 ⟹ ENSRNOP00000026496

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	181,295,562 - 181,300,534 (-)	Ensembl
Rnor_6.0 Ensembl	1	198,123,884 - 198,128,857 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106786 ⟹ ENSRNOP00000086349

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	181,295,671 - 181,300,534 (-)	Ensembl

RefSeq Acc Id:

NM_130411 ⟹ NP_569095

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	190,726,129 - 190,731,103 (-)	NCBI
mRatBN7.2	1	181,295,561 - 181,300,535 (-)	NCBI
Rnor_6.0	1	198,123,883 - 198,128,857 (-)	NCBI
Rnor_5.0	1	205,102,882 - 205,107,884 (-)	NCBI
RGSC_v3.4	1	185,852,741 - 185,857,715 (-)	RGD
Celera	1	178,953,035 - 178,958,009 (-)	RGD

Sequence:

show sequence

CATTGTCTTGACAGAGCATCCTCGGTGGCCAGCCTGCGGCTCCTCCATCCTTCTCTCCTGCCTC
CTCCACTTGGGAGGGGTCACGCTCAGCTCTCCGCAGCAGGATGAGCCGGCAGGTGGTTCGCTCC
AGCAAATTCCGCCACGTGTTTGGACAGCCAGCCAAAGCTGACCAGTGCTATGAGGATGTGCGCG
TCTCACAAACCACTTGGGACAGTGGCTTCTGCGCTGTCAACCCCAAGTTCATGGCTCTGATCTG
TGAGGCCAGTGGGGGAGGGGCCTTCCTGGTGCTACCCCTAGGCAAGACTGGACGAGTAGACAAG
AATGTGCCCCTGGTGTGCGGCCACACTGCCCCTGTGCTAGACATCGCCTGGTGTCCACACAATG
ACAACGTCATTGCCAGTGGCTCTGAGGACTGCACAGTTATGGTGTGGGAGATCCCGGATGGGGG
CCTGGTGCTGCCCTTGCGGGAGCCTGTTGTCACCTTGGAGGGCCACACCAAGCGGGTTGGCATC
GTGGCCTGGCACCCCACAGCCCAGAATGTACTGCTCAGCGCAGGTTGTGACAATGTGATCCTGG
TGTGGGATGTGGGCACTGGGGCAGCCGTGCTGACGCTGGGCCCGGATGTGCACCCGGACACAAT
CTACAGTGTGGATTGGAGCCGGGATGGTGCTCTCATCTGTACCTCCTGCCGTGACAAGCGTGTT
CGCGTCATCGAGCCTCGCAAAGGCACTGTTGTGGCTGAGAAGGAGCGTCCTCATGAGGGAACTC
GGCCAGTGCATGCTGTGTTTGTGTCAGAAGGGAAGATTCTAACCACGGGGTTCAGTCGCATGAG
TGAGCGGCAGGTGGCGCTGTGGGACACAAAGCACCTGGAGGAGCCACTGTCCCTGCAGGAGCTG
GACACAAGCAGTGGAGTCCTGCTACCTTTTTTTGACCCTGATACCAACATCGTCTACCTCTGTG
GCAAGGGTGACAGCTCTATCCGGTATTTTGAGATCACGTCTGAGGCTCCGTTCCTGCATTATCT
TTCCATGTTCAGTTCCAAGGAGTCTCAACGTGGTATGGGCTACATGCCCAAACGTGGCCTGGAA
GTGAATAAGTGCGAGATTGCCAGATTCTATAAGCTTCATGAGCGGAAATGTGAGCCTATTGCCA
TGACAGTGCCTAGAAAGTCGGACCTGTTCCAGGAGGACCTGTATCCACCCACTGCCGGACCCGA
CCCCGCCCTCACAGCTGAGGAGTGGCTGAGCGGTCGTGATGCTGGCCCCCTCCTCATTTCCCTC
AAGGATGGCTACGTGCCCCCAAAGAGCAGGGAGCTGAGAGTCAACAGGGGCCTGGACAGTGCTC
GCAGAAGAGCTACACCGGAGCCCAGTAGCACTCTTAGCTCGGACACCGTGTCACGGCTGGAGGA
GGATGTGAGGAATCTCAACGCCATAGTGCAAAAGCTTCAAGAGCGCCTGGACAGGCTGGAGGAG
ACTGTTCAGGCCAAGTAGAAGACTCCAGAGCCTTCATCTGGGGCCAGCCATTTACTCTGCTCCC
ACCCCAACCCTCAGGCCATATGGTGGATAAGACGAAAATAATAAAACGGCTTTATTTTCTGGTA
AAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017588709 ⟹ XP_017444198

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	190,726,129 - 190,731,133 (-)	NCBI
mRatBN7.2	1	181,295,561 - 181,300,566 (-)	NCBI
Rnor_6.0	1	198,123,883 - 198,128,890 (-)	NCBI

Sequence:

show sequence

CCAGAGGAGGCCGGCGCACGGCCGCTGCTCATTCATTGTCTTGACAGAGCATCCTCGGTGGCCA
GCCTGCGGCTCCTCCATCCTTCTCTCCTGCCTCCTCCACTTGGGAGGGGTCACGCTCAGCTCTC
CGCAGCAGTTTACAATCTGTGTCCTTCAGGATGAGCCGGCAGGTGGTTCGCTCCAGCAAATTCC
GCCACGTGTTTGGACAGCCAGCCAAAGCTGACCAGTGCTATGAGGATGTGCGCGTCTCACAAAC
CACTTGGGACAGTGGCTTCTGCGCTGTCAACCCCAAGTTCATGGCTCTGATCTGTGAGGCCAGT
GGGGGAGGGGCCTTCCTGGTGCTACCCCTAGGCAAGACTGGACGAGTAGACAAGAATGTGCCCC
TGGTGTGCGGCCACACTGCCCCTGTGCTAGACATCGCCTGGTGTCCACACAATGACAACGTCAT
TGCCAGTGGCTCTGAGGACTGCACAGTTATGGTGTGGGAGATCCCGGATGGGGGCCTGGTGCTG
CCCTTGCGGGAGCCTGTTGTCACCTTGGAGGGCCACACCAAGCGGGTTGGCATCGTGGCCTGGC
ACCCCACAGCCCAGAATGTACTGCTCAGCGCAGGTTGTGACAATGTGATCCTGGTGTGGGATGT
GGGCACTGGGGCAGCCGTGCTGACGCTGGGCCCGGATGTGCACCCGGACACAATCTACAGTGTG
GATTGGAGCCGGGATGGTGCTCTCATCTGTACCTCCTGCCGTGACAAGCGTGTTCGCGTCATCG
AGCCTCGCAAAGGCACTGTTGTGGCTGAGAAGGAGCGTCCTCATGAGGGAACTCGGCCAGTGCA
TGCTGTGTTTGTGTCAGAAGGGAAGATTCTAACCACGGGGTTCAGTCGCATGAGTGAGCGGCAG
GTGGCGCTGTGGGACACAAAGCACCTGGAGGAGCCACTGTCCCTGCAGGAGCTGGACACAAGCA
GTGGAGTCCTGCTACCTTTTTTTGACCCTGATACCAACATCGTCTACCTCTGTGGCAAGGGTGA
CAGCTCTATCCGGTATTTTGAGATCACGTCTGAGGCTCCGTTCCTGCATTATCTTTCCATGTTC
AGTTCCAAGGAGTCTCAACGTGGTATGGGCTACATGCCCAAACGTGGCCTGGAAGTGAATAAGT
GCGAGATTGCCAGATTCTATAAGCTTCATGAGCGGAAATGTGAGCCTATTGCCATGACAGTGCC
TAGAAAGTCGGACCTGTTCCAGGAGGACCTGTATCCACCCACTGCCGGACCCGACCCCGCCCTC
ACAGCTGAGGAGTGGCTGAGCGGTCGTGATGCTGGCCCCCTCCTCATTTCCCTCAAGGATGGCT
ACGTGCCCCCAAAGAGCAGGGAGCTAAGAGTCAACAGGGGCCTGGACAGTGCTCGCAGAAGAGC
TACACCGGAGCCCAGTAGCACTCTTAGCTCGGACACCGTGTCACGGCTGGAGGAGGATGTGAGG
AATCTCAACGCCATAGTGCAAAAGCTTCAAGAGCGCCTGGACAGGCTGGAGGAGACTGTTCAGG
CCAAGTAGAAGACTCCAGAGCCTTCATCTGGGGCCAGCCATTTACTCTGCTCCCACCCCAACCC
TCAGGCCATATGGTGGATAAGACGAAAATAATAAAACGGCTTTATTTTCTGGTA

hide sequence

RefSeq Acc Id:

XM_039083423 ⟹ XP_038939351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	190,726,129 - 190,730,562 (-)	NCBI
mRatBN7.2	1	181,295,561 - 181,299,884 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_569095	(Get FASTA)	NCBI Sequence Viewer
	XP_017444198	(Get FASTA)	NCBI Sequence Viewer
	XP_038939351	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86971	(Get FASTA)	NCBI Sequence Viewer
	AAL18695	(Get FASTA)	NCBI Sequence Viewer
	AAM18515	(Get FASTA)	NCBI Sequence Viewer
	EDM17409	(Get FASTA)	NCBI Sequence Viewer
	EDM17410	(Get FASTA)	NCBI Sequence Viewer
	EDM17411	(Get FASTA)	NCBI Sequence Viewer
	EDM17412	(Get FASTA)	NCBI Sequence Viewer
	EDM17413	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026496
	ENSRNOP00000026496.2
	ENSRNOP00000086349.1
GenBank Protein	Q91ZN1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_569095 ⟸ NM_130411

- UniProtKB:

Q91ZN1 (UniProtKB/Swiss-Prot), A6I9B9 (UniProtKB/TrEMBL), A0A8I6A217 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPL
GKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVVTLE
GHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALIC
TSCRDKRVRVIEPRKGTVVAEKERPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLE
EPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMG
YMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLSGRD
AGPLLISLKDGYVPPKSRELRVNRGLDSARRRATPEPSSTLSSDTVSRLEEDVRNLNAIVQKLQ
ERLDRLEETVQAK

hide sequence

RefSeq Acc Id:	XP_017444198 ⟸ XM_017588709
- Peptide Label:	isoform X1
- UniProtKB:	Q91ZN1 (UniProtKB/Swiss-Prot), A6I9B9 (UniProtKB/TrEMBL), A0A8I6A217 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPL GKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVVTLE GHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALIC TSCRDKRVRVIEPRKGTVVAEKERPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLE EPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMG YMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLSGRD AGPLLISLKDGYVPPKSRELRVNRGLDSARRRATPEPSSTLSSDTVSRLEEDVRNLNAIVQKLQ ERLDRLEETVQAK hide sequence

Ensembl Acc Id:

ENSRNOP00000026496 ⟸ ENSRNOT00000026496

RefSeq Acc Id:	XP_038939351 ⟸ XM_039083423
- Peptide Label:	isoform X1
- UniProtKB:	Q91ZN1 (UniProtKB/Swiss-Prot), A6I9B9 (UniProtKB/TrEMBL), A0A8I6A217 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000086349 ⟸ ENSRNOT00000106786

Protein Domains

DUF1899 Trimerisation motif

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91ZN1-F1-model_v2	AlphaFold	Q91ZN1	1-461	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690408

Promoter ID:

EPDNEW_R933

Type:

multiple initiation site

Name:

Coro1a_1

Description:

coronin 1A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	198,128,856 - 198,128,916	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620009	AgrOrtholog
BioCyc Gene	G2FUF-57430	BioCyc
Ensembl Genes	ENSRNOG00000019430	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026496	ENTREZGENE
	ENSRNOT00000026496.4	UniProtKB/Swiss-Prot
	ENSRNOT00000106786.1	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7124429	IMAGE-MGC_LOAD
InterPro	Coronin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DUF1899	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trimer_CC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:155151	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93041	IMAGE-MGC_LOAD
NCBI Gene	155151	ENTREZGENE
PANTHER	PTHR10856	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10856:SF18	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DUF1899	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trimer_CC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Coro1a	PhenoGen
PROSITE	WD_REPEATS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_REGION	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019430	RatGTEx
SMART	DUF1899	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DUF1900	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A217	ENTREZGENE, UniProtKB/TrEMBL
	A6I9B7_RAT	UniProtKB/TrEMBL
	A6I9B9	ENTREZGENE, UniProtKB/TrEMBL
	A6I9C1_RAT	UniProtKB/TrEMBL
	COR1A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-20	Coro1a	coronin 1A	Coro1a	coronin, actin binding protein 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Coro1a	coronin, actin binding protein 1A			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Coro1a	coronin, actin binding protein 1A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)