Advanced Search (OLGA)

Gene: Ido1 (indoleamine 2,3-dioxygenase 1) Rattus norvegicus

Analyze

Symbol:

Ido1

Name:

indoleamine 2,3-dioxygenase 1

RGD ID:

619989

Description:

Enables amino acid binding activity; indoleamine 2,3-dioxygenase activity; and oxygen binding activity. Involved in L-tryptophan catabolic process to kynurenine. Predicted to be located in smooth muscle contractile fiber and stereocilium bundle. Predicted to be active in cytoplasm. Orthologous to human IDO1 (indoleamine 2,3-dioxygenase 1); PARTICIPATES IN tryptophan metabolic pathway; kynurenine metabolic pathway; sleeping sickness pathway; INTERACTS WITH ammonium chloride; atrazine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ido; IDO-1; Indo; indoleamine 2,3-dioxygenase; indoleamine 23-dioxygenase; indoleamine-pyrrole 2,3 dioxygenase; indoleamine-pyrrole 2,3-dioxygenase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IDO1 (indoleamine 2,3-dioxygenase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ido1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ido1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IDO1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IDO1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ido1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IDO1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IDO1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ido1 (indoleamine 2,3-dioxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SF3A1 (splicing factor 3a subunit 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Ido1 (indoleamine 2,3-dioxygenase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IDO1 (indoleamine 2,3-dioxygenase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BNA2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	74,133,259 - 74,145,328 (+)	NCBI		GRCr8
mRatBN7.2	16	67,430,654 - 67,442,726 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	67,430,578 - 67,442,730 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	72,707,823 - 72,719,592 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	76,112,135 - 76,124,005 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	71,361,330 - 71,373,199 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	72,216,326 - 72,228,098 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	72,216,326 - 72,228,098 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	71,866,330 - 71,878,339 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	71,866,340 - 71,878,373 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	71,866,604 - 71,878,638 (+)	NCBI
Celera	16	65,330,156 - 65,341,814 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	acquired immunodeficiency syndrome		ISO	RGD:1346818	39939073	associated with pulmonary tuberculosis;protein:increased expression:blood (human)	RGD
Ido1	Rat	Acute Lung Injury	treatment	ISO	RGD:731346	39939031		RGD
Ido1	Rat	Animal Toxoplasmosis		ISO	RGD:731346	39939039		RGD
Ido1	Rat	chlamydia	treatment	ISO	RGD:1346818	38455984		RGD
Ido1	Rat	chlamydia		ISO	RGD:731346	39938856	mRNA:increased expression:lung (mouse)	RGD
Ido1	Rat	Chronic Hepatitis B		ISO	RGD:1346818	39939037	protein:increased expression:serum (human)	RGD
Ido1	Rat	Chronic Hepatitis C		ISO	RGD:1346818	39939081	mRNA, protein:increased expression, increased activity:monocytes,myeloid dendritic cells,serum (human)	RGD
Ido1	Rat	Cognitive Dysfunction		ISO	RGD:731346	39939118	associated with Pneumococcal Meningitis	RGD
Ido1	Rat	dengue disease	treatment	ISO	RGD:1346818	39939074		RGD
Ido1	Rat	eczema herpeticum	severity	ISO	RGD:1346818	11528429	associated with atopic dermatitis; protein:increased activity:serum (human)	RGD
Ido1	Rat	Endotoxemia		ISO	RGD:731346	39939032		RGD
Ido1	Rat	Endotoxemia		ISO	RGD:731346	39939117		RGD
Ido1	Rat	Experimental Liver Cirrhosis	severity	ISO	RGD:731346	39939037	protein:increased expression:serum (mouse)	RGD
Ido1	Rat	Experimental Liver Cirrhosis		ISO	RGD:731346	39939037		RGD
Ido1	Rat	hemophagocytic lymphohistiocytosis		ISO	RGD:731346	11529541		RGD
Ido1	Rat	paracoccidioidomycosis		ISO	RGD:731346	39939072	mRNA, protein:decreased expression, decreased activity:lung,plasmacytoid dendritic cell (mouse)	RGD
Ido1	Rat	Pneumococcal Meningitis	treatment	ISO	RGD:731346	39939118		RGD
Ido1	Rat	pneumonic tularemia		ISO	RGD:731346	39938865		RGD
Ido1	Rat	pulmonary tuberculosis	treatment	ISO	RGD:1346818	39939073		RGD
Ido1	Rat	Salmonella Infections, Animal	susceptibility	ISO	RGD:731346	39939032		RGD
Ido1	Rat	Sepsis	treatment	ISO	RGD:731346	39938864		RGD
Ido1	Rat	shigellosis	treatment	ISO	RGD:731346	39938959		RGD
Ido1	Rat	Streptococcus pneumonia		ISO	RGD:731346	39938865	mRNA:increased expression:lung (mouse)	RGD
Ido1	Rat	swine influenza		ISO	RGD:731346	39939082		RGD
Ido1	Rat	swine influenza	disease_progression	ISO	RGD:731346	39939079		RGD
Ido1	Rat	Systemic Juvenile Rheumatoid Arthritis		ISO	RGD:731346	11529541		RGD
Ido1	Rat	toxic shock syndrome	severity	ISO	RGD:1346818	39939075	protein:increased activity, increased expression:plasma, heart (human)	RGD
Ido1	Rat	viral encephalitis		ISO	RGD:731346	39939045		RGD
Ido1	Rat	Viral Myocarditis		ISO	RGD:731346	39939047		RGD
Ido1	Rat	vulvovaginal candidiasis		ISO	RGD:731346	39938863		RGD

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	B-lymphoblastic leukemia/lymphoma		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:35687267
Ido1	Rat	Breast Neoplasms		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18925433
Ido1	Rat	endometriosis		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21063030
Ido1	Rat	Inflammation		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16365156
Ido1	Rat	Neoplasm Recurrence, Local		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18925433
Ido1	Rat	neurodegenerative disease		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16365156
Ido1	Rat	obesity		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27020609
Ido1	Rat	Weight Gain		ISO	RGD:1346818	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27020609

Imported Disease Annotations - MGI

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	pre-eclampsia		ISS	RGD:731346	13592920	OMIM:189800 \| OMIM:609402 \| OMIM:609403 \| OMIM:609404 \| OMIM:614592	MouseDO

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	(S)-amphetamine	increases expression	ISO	RGD:731346	6480464	Dextroamphetamine results in increased expression of IDO1 protein	CTD	PMID:31760073
Ido1	Rat	(S)-amphetamine	multiple interactions	ISO	RGD:731346	6480464	[Lithium Chloride results in increased abundance of Lithium] inhibits the reaction [Dextroamphetamine results in increased more ...	CTD	PMID:31760073
Ido1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:731346	6480464	1,2-Dimethylhydrazine results in decreased expression of IDO1 mRNA	CTD	PMID:22206623
Ido1	Rat	17beta-estradiol	increases expression	ISO	RGD:731346	6480464	Estradiol results in increased expression of IDO1 mRNA; Estradiol results in increased expression of INDO more ...	CTD	PMID:18367319\|PMID:19484750
Ido1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1346818	6480464	Estradiol results in decreased expression of IDO1 mRNA	CTD	PMID:36828454
Ido1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:731346	6480464	bazedoxifene inhibits the reaction [Estradiol results in increased expression of IDO1 mRNA]; Lasofoxifene inhibits the more ...	CTD	PMID:18367319
Ido1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:1346818	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of IDO1 protein	CTD	PMID:31675489
Ido1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:731346	6480464	[[Lipopolysaccharides binds to and results in increased activity of TLR4 protein] which co-treated with Tetrachlorodibenzodioxin] more ...	CTD	PMID:21097750
Ido1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:731346	6480464	Tetrachlorodibenzodioxin results in increased expression of IDO1 mRNA	CTD	PMID:18694728\|PMID:20350561\|PMID:21131560\|PMID:23798565\|PMID:23999131
Ido1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1346818	6480464	3'-methoxy-4'-nitroflavone inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of IDO1 mRNA]	CTD	PMID:18694728
Ido1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1346818	6480464	Tetrachlorodibenzodioxin results in increased expression of IDO1 mRNA	CTD	PMID:18694728\|PMID:27783115
Ido1	Rat	2,4,6-tribromophenol	decreases expression	ISO	RGD:1346818	6480464	2,4,6-tribromophenol results in decreased expression of IDO1 mRNA	CTD	PMID:31675489
Ido1	Rat	2,4,6-trinitrobenzenesulfonic acid	increases expression	ISO	RGD:731346	6480464	Trinitrobenzenesulfonic Acid results in increased expression of IDO1 mRNA	CTD	PMID:17982090
Ido1	Rat	3',5'-cyclic AMP	multiple interactions	ISO	RGD:1346818	6480464	2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [[IFNG protein co-treated with [Medroxyprogesterone Acetate co-treated with Cyclic more ...	CTD	PMID:32781018
Ido1	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:1346818	6480464	tetrabromobisphenol A results in decreased expression of IDO1 protein	CTD	PMID:31675489
Ido1	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:731346	6480464	tetrabromobisphenol A results in decreased expression of IDO1 protein	CTD	PMID:35343813
Ido1	Rat	3,3',5,5'-tetrabromobisphenol A	increases methylation	ISO	RGD:731346	6480464	tetrabromobisphenol A results in increased methylation of IDO1 gene	CTD	PMID:35343813
Ido1	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:1346818	6480464	Decitabine affects the expression of IDO1 mRNA	CTD	PMID:23300844
Ido1	Rat	acetylsalicylic acid	affects response to substance	ISO	RGD:1346818	6480464	IDO1 affects the susceptibility to Aspirin	CTD	PMID:19489917
Ido1	Rat	aconitic acid	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	acyclovir	decreases activity	ISO	RGD:1346818	6480464	Acyclovir results in decreased activity of IDO1 protein	CTD	PMID:17174341
Ido1	Rat	aldehydo-D-glucose	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of IDO1 mRNA	CTD	PMID:16483693
Ido1	Rat	anthranilic acid	decreases abundance	ISO	RGD:731346	6480464	IDO1 gene mutant form results in decreased abundance of anthranilic acid	CTD	PMID:32871117
Ido1	Rat	arsenite(3-)	decreases methylation	ISO	RGD:1346818	6480464	arsenite results in decreased methylation of INDO promoter	CTD	PMID:23974009
Ido1	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of IDO1 gene	CTD	PMID:28931070
Ido1	Rat	bazedoxifene	multiple interactions	ISO	RGD:731346	6480464	bazedoxifene inhibits the reaction [Estradiol results in increased expression of IDO1 mRNA]	CTD	PMID:18367319
Ido1	Rat	belinostat	multiple interactions	ISO	RGD:1346818	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Ido1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1346818	6480464	Benzo(a)pyrene results in increased expression of IDO1 mRNA	CTD	PMID:20064835
Ido1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1346818	6480464	Benzo(a)pyrene results in increased methylation of IDO1 promoter	CTD	PMID:27901495
Ido1	Rat	beta-D-fructofuranose 1,6-bisphosphate	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1346818	6480464	Diethylhexyl Phthalate results in decreased expression of IDO1 mRNA	CTD	PMID:31163220
Ido1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IDO1 mRNA	CTD	PMID:25181051
Ido1	Rat	bisphenol A	decreases expression	ISO	RGD:731346	6480464	bisphenol A results in decreased expression of IDO1 protein	CTD	PMID:35343813
Ido1	Rat	bisphenol A	increases methylation	ISO	RGD:731346	6480464	bisphenol A results in increased methylation of IDO1 gene	CTD	PMID:35343813
Ido1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of IDO1 gene	CTD	PMID:28505145
Ido1	Rat	bisphenol F	increases expression	ISO	RGD:731346	6480464	bisphenol F results in increased expression of IDO1 protein	CTD	PMID:38266696
Ido1	Rat	buta-1,3-diene	decreases expression	ISO	RGD:731346	6480464	1,3-butadiene results in decreased expression of IDO1 mRNA	CTD	PMID:29038090
Ido1	Rat	butanal	increases expression	ISO	RGD:1346818	6480464	butyraldehyde results in increased expression of IDO1 mRNA	CTD	PMID:26079696
Ido1	Rat	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of IDO1 more ...	CTD	PMID:35489423
Ido1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of IDO1 promoter	CTD	PMID:22457795
Ido1	Rat	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of IDO1 more ...	CTD	PMID:35489423
Ido1	Rat	cannabidiol	multiple interactions	ISO	RGD:1346818	6480464	AM 281 promotes the reaction [Cannabidiol inhibits the reaction [Plant Preparations results in increased activity more ...	CTD	PMID:19167098
Ido1	Rat	cannabidiol	increases expression	ISO	RGD:1346818	6480464	Cannabidiol results in increased expression of IDO1 mRNA; Cannabidiol results in increased expression of IDO1 more ...	CTD	PMID:38663822
Ido1	Rat	carbon nanotube	increases expression	ISO	RGD:1346818	6480464	Nanotubes, Carbon results in increased expression of IDO1 mRNA	CTD	PMID:29348435
Ido1	Rat	chromium(6+)	affects expression	ISO	RGD:731346	6480464	chromium hexavalent ion affects the expression of IDO1 mRNA	CTD	PMID:28472532
Ido1	Rat	cisplatin	affects expression	ISO	RGD:1346818	6480464	Cisplatin affects the expression of IDO1 mRNA	CTD	PMID:23300844
Ido1	Rat	cisplatin	multiple interactions	ISO	RGD:1346818	6480464	[Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of IDO1 mRNA	CTD	PMID:30871063
Ido1	Rat	cisplatin	increases expression	ISO	RGD:1346818	6480464	Cisplatin results in increased expression of IDO1 mRNA	CTD	PMID:27392435
Ido1	Rat	curcumin	decreases expression	ISO	RGD:1346818	6480464	Curcumin results in decreased expression of IDO1 mRNA	CTD	PMID:18348204
Ido1	Rat	cyclophosphamide	multiple interactions	EXP		6480464	Cyclophosphamide results in increased expression of and results in increased activity of IDO1 protein; Quercetin more ...	CTD	PMID:34748891\|PMID:35906875
Ido1	Rat	cyclophosphamide	increases expression	EXP		6480464	Cyclophosphamide results in increased expression of IDO1 protein	CTD	PMID:34748891
Ido1	Rat	D-fructofuranose 1,6-bisphosphate	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	D-glucopyranose 6-phosphate	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	D-glucose	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	decabromodiphenyl ether	decreases expression	ISO	RGD:1346818	6480464	decabromobiphenyl ether results in decreased expression of IDO1 protein	CTD	PMID:31675489
Ido1	Rat	dextran sulfate	increases expression	ISO	RGD:731346	6480464	Dextran Sulfate results in increased expression of IDO1 mRNA	CTD	PMID:23894361
Ido1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1346818	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Ido1	Rat	entinostat	increases expression	ISO	RGD:1346818	6480464	entinostat results in increased expression of IDO1 mRNA	CTD	PMID:26272509
Ido1	Rat	entinostat	multiple interactions	ISO	RGD:1346818	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Ido1	Rat	ethanol	increases expression	ISO	RGD:731346	6480464	Ethanol results in increased expression of IDO1 mRNA	CTD	PMID:35863473
Ido1	Rat	ethanol	multiple interactions	ISO	RGD:731346	6480464	Ethanol promotes the reaction [Dietary Fats results in increased expression of IDO1 mRNA]	CTD	PMID:35863473
Ido1	Rat	fumaric acid	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	gadodiamide hydrate	increases expression	ISO	RGD:1346818	6480464	gadodiamide results in increased expression of IDO1 mRNA	CTD	PMID:20959327
Ido1	Rat	glucose	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	glycerol 1-phosphate	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	hexachlorobenzene	increases expression	ISO	RGD:731346	6480464	Hexachlorobenzene results in increased expression of IDO1 mRNA	CTD	PMID:37169060
Ido1	Rat	hyaluronic acid	multiple interactions	EXP		6480464	Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of IDO1 protein]	CTD	PMID:23178681
Ido1	Rat	hyaluronic acid	decreases expression	EXP		6480464	Hyaluronic Acid analog results in decreased expression of IDO1 protein	CTD	PMID:23178681
Ido1	Rat	hydrogen peroxide	multiple interactions	EXP		6480464	Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of IDO1 protein]	CTD	PMID:23178681
Ido1	Rat	hydrogen peroxide	increases expression	ISO	RGD:1346818	6480464	Hydrogen Peroxide results in increased expression of IDO1 protein	CTD	PMID:36368423
Ido1	Rat	hydrogen peroxide	decreases expression	EXP		6480464	Hydrogen Peroxide results in decreased expression of IDO1 protein	CTD	PMID:23178681
Ido1	Rat	Indeno[1,2,3-cd]pyrene	increases expression	ISO	RGD:1346818	6480464	indeno(1,2,3-cd)pyrene results in increased expression of IDO1 protein	CTD	PMID:35687267
Ido1	Rat	indirubin-3'-monoxime	increases expression	ISO	RGD:731346	6480464	indirubin-3'-monoxime results in increased expression of IDO1 protein	CTD	PMID:21948866
Ido1	Rat	indirubin-3'-monoxime	multiple interactions	ISO	RGD:731346	6480464	Lipopolysaccharides affects the susceptibility to [indirubin-3'-monoxime results in increased expression of IDO1 protein]	CTD	PMID:21948866
Ido1	Rat	indole-3-methanol	increases expression	ISO	RGD:731346	6480464	indole-3-carbinol results in increased expression of IDO1 mRNA	CTD	PMID:21948866
Ido1	Rat	indole-3-methanol	multiple interactions	ISO	RGD:731346	6480464	Lipopolysaccharides affects the susceptibility to [indole-3-carbinol results in increased expression of IDO1 mRNA]	CTD	PMID:21948866
Ido1	Rat	indolin-2-one	increases expression	ISO	RGD:1346818	6480464	2-oxindole results in increased expression of IDO1 protein	CTD	PMID:36368423
Ido1	Rat	keto-D-fructose 1,6-bisphosphate	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	kynurenine	decreases abundance	ISO	RGD:731346	6480464	IDO1 gene mutant form results in decreased abundance of Kynurenine	CTD	PMID:32871117
Ido1	Rat	L-tryptophan	increases abundance	ISO	RGD:731346	6480464	IDO1 gene mutant form results in increased abundance of Tryptophan	CTD	PMID:32871117
Ido1	Rat	L-tryptophan	increases expression	ISO	RGD:1346818	6480464	Tryptophan results in increased expression of IDO1 protein	CTD	PMID:32781018
Ido1	Rat	lasofoxifene	increases expression	ISO	RGD:731346	6480464	Lasofoxifene results in increased expression of IDO1 mRNA	CTD	PMID:18367319
Ido1	Rat	lasofoxifene	multiple interactions	ISO	RGD:731346	6480464	Lasofoxifene inhibits the reaction [Estradiol results in increased expression of IDO1 mRNA]	CTD	PMID:18367319
Ido1	Rat	lead diacetate	increases expression	ISO	RGD:731346	6480464	lead acetate results in increased expression of IDO1 mRNA	CTD	PMID:20542052
Ido1	Rat	lipopolysaccharide	increases expression	ISO	RGD:1346818	6480464	Lipopolysaccharides results in increased expression of IDO1 mRNA	CTD	PMID:20884048\|PMID:27783115\|PMID:35811015
Ido1	Rat	lipopolysaccharide	increases expression	ISO	RGD:731346	6480464	Lipopolysaccharides results in increased expression of IDO1 mRNA	CTD	PMID:33038329
Ido1	Rat	lipopolysaccharide	increases activity	ISO	RGD:731346	39939031	Lipopolysaccharide increases activity of Ido1 protein in splenic conventional dendritic cell	RGD
Ido1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1346818	11528429	lipopolysaccharide increases activity and expression of IDO1 protein in Langerhans cell-like dendritic cells	RGD
Ido1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:731346	6480464	3-(4-chlorophenylselanyl)-1-methyl-1H-indole inhibits the reaction [Lipopolysaccharides results in increased expression of IDO1 mRNA]; [[Lipopolysaccharides binds to more ...	CTD	PMID:21097750\|PMID:21948866\|PMID:33038329
Ido1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1346818	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of IDO1 mRNA; S-(1,2-dichlorovinyl)cysteine inhibits the reaction more ...	CTD	PMID:20884048\|PMID:35811015
Ido1	Rat	lithium atom	multiple interactions	ISO	RGD:731346	6480464	[Lithium Chloride results in increased abundance of Lithium] inhibits the reaction [Dextroamphetamine results in increased more ...	CTD	PMID:31760073
Ido1	Rat	lithium chloride	multiple interactions	ISO	RGD:731346	6480464	[Lithium Chloride results in increased abundance of Lithium] inhibits the reaction [Dextroamphetamine results in increased more ...	CTD	PMID:31760073
Ido1	Rat	lithium hydride	multiple interactions	ISO	RGD:731346	6480464	[Lithium Chloride results in increased abundance of Lithium] inhibits the reaction [Dextroamphetamine results in increased more ...	CTD	PMID:31760073
Ido1	Rat	malathion	increases expression	ISO	RGD:1346818	6480464	Malathion results in increased expression of IDO1 mRNA	CTD	PMID:37047231
Ido1	Rat	malic acid	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	medroxyprogesterone acetate	multiple interactions	ISO	RGD:1346818	6480464	2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [[IFNG protein co-treated with [Medroxyprogesterone Acetate co-treated with Cyclic more ...	CTD	PMID:32781018
Ido1	Rat	muramyl dipeptide	increases expression	ISO	RGD:731346	39938959	muramyl dipeptide increases expression of Ido1 mRNA in peritoneal macrophages and splenocytes	RGD
Ido1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of IDO1 mRNA	CTD	PMID:20360939
Ido1	Rat	neopterin	multiple interactions	ISO	RGD:1346818	6480464	[Plant Preparations results in increased activity of IDO1 protein] which results in increased abundance of more ...	CTD	PMID:19167098
Ido1	Rat	nickel atom	increases expression	ISO	RGD:1346818	6480464	Nickel results in increased expression of IDO1 mRNA	CTD	PMID:24768652\|PMID:25583101
Ido1	Rat	nickel sulfate	increases expression	ISO	RGD:1346818	6480464	nickel sulfate results in increased expression of IDO1 mRNA	CTD	PMID:16780908
Ido1	Rat	nitric oxide	multiple interactions	ISO	RGD:1346818	6480464	Nitric Oxide binds to and affects the folding of and results in increased degradation of more ...	CTD	PMID:16834326
Ido1	Rat	nitroglycerin	decreases expression	EXP		6480464	Nitroglycerin results in decreased expression of IDO1 protein	CTD	PMID:28659861
Ido1	Rat	ozone	multiple interactions	ISO	RGD:731346	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:34911549\|PMID:36675130
Ido1	Rat	ozone	multiple interactions	ISO	RGD:1346818	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of IDO1 mRNA	CTD	PMID:35430440
Ido1	Rat	paracetamol	affects expression	ISO	RGD:731346	6480464	Acetaminophen affects the expression of IDO1 mRNA	CTD	PMID:17562736
Ido1	Rat	perfluorododecanoic acid	increases expression	EXP		6480464	perfluorododecanoic acid results in increased expression of IDO1 protein	CTD	PMID:19854247
Ido1	Rat	phenethyl caffeate	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of IDO1 mRNA	CTD	PMID:20360939
Ido1	Rat	PhIP	increases expression	EXP		6480464	2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of IDO1 mRNA	CTD	PMID:33945839
Ido1	Rat	pirinixic acid	multiple interactions	ISO	RGD:731346	6480464	NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of IDO1 mRNA]	CTD	PMID:17950772
Ido1	Rat	pirinixic acid	decreases expression	ISO	RGD:731346	6480464	pirinixic acid results in decreased expression of IDO1 mRNA	CTD	PMID:17426115\|PMID:17950772
Ido1	Rat	poly(I:C)	increases expression	ISO	RGD:1346818	6480464	Poly I-C results in increased expression of IDO1 mRNA	CTD	PMID:27783115
Ido1	Rat	poly(I:C)	multiple interactions	ISO	RGD:1346818	11528429	poly(I:C) co-treated with tryptophan or alone increases activity and expression of IDO1 protein in Langerhans more ...	RGD
Ido1	Rat	quercetin	increases expression	ISO	RGD:1346818	6480464	Quercetin results in increased expression of IDO1 protein	CTD	PMID:15221776
Ido1	Rat	quercetin	affects binding	ISO	RGD:1346818	6480464	Quercetin binds to IDO1 protein	CTD	PMID:35906875
Ido1	Rat	quercetin	multiple interactions	EXP		6480464	Quercetin inhibits the reaction [Cyclophosphamide results in increased activity of IDO1 protein]; Quercetin inhibits the more ...	CTD	PMID:34748891\|PMID:35906875
Ido1	Rat	raloxifene	increases expression	ISO	RGD:731346	6480464	Raloxifene Hydrochloride results in increased expression of IDO1 mRNA	CTD	PMID:18367319
Ido1	Rat	raloxifene	multiple interactions	ISO	RGD:731346	6480464	Raloxifene Hydrochloride inhibits the reaction [Estradiol results in increased expression of IDO1 mRNA]	CTD	PMID:18367319
Ido1	Rat	resveratrol	affects activity	ISO	RGD:1346818	6480464	resveratrol affects the activity of IDO1 protein	CTD	PMID:16154495
Ido1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1346818	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of IDO1 mRNA; S-(1,2-dichlorovinyl)cysteine inhibits the reaction more ...	CTD	PMID:35811015
Ido1	Rat	Salinomycin	multiple interactions	ISO	RGD:1346818	6480464	salinomycin binds to and results in decreased activity of IDO1 protein; salinomycin inhibits the reaction more ...	CTD	PMID:32822738
Ido1	Rat	SB 431542	multiple interactions	ISO	RGD:1346818	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Ido1	Rat	simvastatin	increases expression	ISO	RGD:1346818	6480464	Simvastatin results in increased expression of IDO1	CTD	PMID:20491794
Ido1	Rat	sodium arsenite	increases expression	ISO	RGD:731346	6480464	sodium arsenite results in increased expression of IDO1 mRNA	CTD	PMID:37682722
Ido1	Rat	succinic acid	multiple interactions	ISO	RGD:731346	6480464	IDO1 protein affects the reaction [[APP protein mutant form co-treated with PSEN1 protein mutant form] more ...	CTD	PMID:39172838
Ido1	Rat	sulfasalazine	multiple interactions	ISO	RGD:1346818	6480464	Sulfasalazine inhibits the reaction [Lipopolysaccharides results in increased expression of IDO1 mRNA]	CTD	PMID:20884048
Ido1	Rat	temozolomide	increases expression	ISO	RGD:1346818	6480464	Temozolomide results in increased expression of IDO1 mRNA	CTD	PMID:31758290
Ido1	Rat	testosterone	increases expression	ISO	RGD:731346	6480464	Testosterone results in increased expression of IDO1 mRNA	CTD	PMID:19693291
Ido1	Rat	testosterone enanthate	affects expression	ISO	RGD:1346818	6480464	testosterone enanthate affects the expression of IDO1 mRNA	CTD	PMID:17440010
Ido1	Rat	tetrachloromethane	increases expression	ISO	RGD:731346	6480464	Carbon Tetrachloride results in increased expression of IDO1 mRNA; Carbon Tetrachloride results in increased expression more ...	CTD	PMID:32289347
Ido1	Rat	tetrachloromethane	increases expression	ISO	RGD:731346	39939037	tetrachloromethane increases expression of Ido1 protein in serum	RGD
Ido1	Rat	trichostatin A	decreases expression	ISO	RGD:1346818	6480464	trichostatin A results in decreased expression of IDO1 mRNA	CTD	PMID:24935251
Ido1	Rat	trimellitic anhydride	affects expression	ISO	RGD:731346	6480464	trimellitic anhydride affects the expression of IDO1 mRNA	CTD	PMID:19042947
Ido1	Rat	valproic acid	affects expression	ISO	RGD:1346818	6480464	Valproic Acid affects the expression of IDO1 mRNA	CTD	PMID:25979313
Ido1	Rat	valproic acid	multiple interactions	ISO	RGD:731346	6480464	Valproic Acid inhibits the reaction [Dextroamphetamine results in increased expression of IDO1 protein]	CTD	PMID:31760073
Ido1	Rat	vinclozolin	decreases methylation	EXP		6480464	vinclozolin results in decreased methylation of IDO1 gene	CTD	PMID:31079544
Ido1	Rat	XL147	multiple interactions	ISO	RGD:731346	6480464	[N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of IDO1 mRNA	CTD	PMID:27935865
Ido1	Rat	zearalenone	decreases expression	ISO	RGD:1346818	6480464	Zearalenone results in decreased expression of IDO1 mRNA	CTD	PMID:36828454
Ido1	Rat	zinc atom	decreases expression	ISO	RGD:1346818	6480464	Zinc results in decreased expression of INDO mRNA	CTD	PMID:18316168
Ido1	Rat	zinc(0)	decreases expression	ISO	RGD:1346818	6480464	Zinc results in decreased expression of INDO mRNA	CTD	PMID:18316168
Ido1	Rat	zoledronic acid	increases expression	ISO	RGD:1346818	6480464	zoledronic acid results in increased expression of IDO1 mRNA; zoledronic acid results in increased expression more ...	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	'de novo' NAD+ biosynthetic process from L-tryptophan	involved_in	IBA	PANTHER:PTN002009580\|SGD:S000003839	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ido1	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ido1	Rat	inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	inflammatory response	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18480171	RGD	PMID:18480171
Ido1	Rat	kynurenic acid biosynthetic process	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	kynurenic acid biosynthetic process	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:19234212	RGD	PMID:19234212
Ido1	Rat	L-tryptophan catabolic process	involved_in	IEA	ARBA:ARBA00026552	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Ido1	Rat	L-tryptophan catabolic process	involved_in	IEA	UniProtKB-KW:KW-0823	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ido1	Rat	L-tryptophan catabolic process to kynurenine		IDA		2290543		RGD
Ido1	Rat	L-tryptophan catabolic process to kynurenine	acts_upstream_of_or_within	ISO	RGD:731346	1624291	PMID:11751753, PMID:2419335	RGD	PMID:11751753\|PMID:2419335
Ido1	Rat	L-tryptophan catabolic process to kynurenine	involved_in	IBA	MGI:2142489\|MGI:96416\|PANTHER:PTN002009580\|RGD:619989\|UniProtKB:Q6ZQW0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ido1	Rat	L-tryptophan catabolic process to kynurenine	involved_in	IEA	InterPro:IPR037217	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ido1	Rat	L-tryptophan catabolic process to kynurenine	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	L-tryptophan catabolic process to kynurenine	involved_in	IEA	UniRule:UR001933754	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ido1	Rat	L-tryptophan catabolic process to kynurenine		IDA		2290190		RGD
Ido1	Rat	multicellular organismal response to stress	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:19234218	RGD	PMID:19234218
Ido1	Rat	multicellular organismal response to stress	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	negative regulation of activated T cell proliferation	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18077788	RGD	PMID:18077788
Ido1	Rat	negative regulation of activated T cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	negative regulation of interleukin-10 production	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:19234212	RGD	PMID:19234212
Ido1	Rat	negative regulation of interleukin-10 production	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	negative regulation of T cell apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	negative regulation of T cell apoptotic process	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18077788	RGD	PMID:18077788
Ido1	Rat	negative regulation of T cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	negative regulation of T cell proliferation	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18077788	RGD	PMID:18077788
Ido1	Rat	positive regulation of apoptotic process	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18480171	RGD	PMID:18480171
Ido1	Rat	positive regulation of apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	positive regulation of chronic inflammatory response	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18436652	RGD	PMID:18436652
Ido1	Rat	positive regulation of chronic inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	positive regulation of interleukin-12 production	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	positive regulation of interleukin-12 production	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:19234212	RGD	PMID:19234212
Ido1	Rat	positive regulation of T cell apoptotic process	involved_in	IEA	UniProtKB:P14902\|ensembl:ENSP00000430950	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	positive regulation of T cell apoptotic process	involved_in	ISO	RGD:1346818	1624291	PMID:25310899	RGD	PMID:25310899
Ido1	Rat	positive regulation of T cell tolerance induction	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	positive regulation of T cell tolerance induction	acts_upstream_of_or_within	ISO	RGD:731346	1624291	PMID:9712583	RGD	PMID:9712583
Ido1	Rat	positive regulation of type 2 immune response	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	positive regulation of type 2 immune response	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:18436652	RGD	PMID:18436652
Ido1	Rat	quinolinate biosynthetic process	involved_in	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	quinolinate biosynthetic process	involved_in	ISO	RGD:731346	1624291	PMID:2419335	RGD	PMID:2419335
Ido1	Rat	regulation of activated T cell proliferation	NOT\|involved_in	ISO	RGD:1346818	1624291	PMID:25310899	RGD	PMID:25310899
Ido1	Rat	response to lipopolysaccharide	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	response to lipopolysaccharide	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:19234212	RGD	PMID:19234212
Ido1	Rat	swimming behavior	acts_upstream_of_or_within	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	swimming behavior	acts_upstream_of_or_within	ISO	RGD:731346	1624291	MGI:3505776 PMID:19234218	RGD	PMID:19234218
Ido1	Rat	T cell proliferation	acts_upstream_of	ISO	RGD:731346	1624291	MGI:3505776 PMID:18077788	RGD	PMID:18077788
Ido1	Rat	T cell proliferation	acts_upstream_of	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ido1	Rat	cytoplasm	located_in	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	cytoplasm	located_in	IEA	UniRule:UR001933754	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ido1	Rat	cytoplasm	located_in	ISO	RGD:731346	1624291	PMID:17671174, PMID:19741271	RGD	PMID:17671174\|PMID:19741271
Ido1	Rat	cytoplasm	is_active_in	IBA	MGI:2142489\|MGI:96416\|PANTHER:PTN002009580	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ido1	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ido1	Rat	smooth muscle contractile fiber	located_in	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	smooth muscle contractile fiber	located_in	ISO	RGD:731346	1624291	PMID:19741271	RGD	PMID:19741271
Ido1	Rat	stereocilium bundle	located_in	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	stereocilium bundle	located_in	ISO	RGD:731346	1624291	PMID:19741271	RGD	PMID:19741271

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	amino acid binding		IDA		2290543		RGD
Ido1	Rat	amino acid binding		IDA		2290190		RGD
Ido1	Rat	dioxygenase activity	enables	IEA	UniProtKB-KW:KW-0223	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ido1	Rat	heme binding	enables	IEA	UniRule:UR001933754	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ido1	Rat	heme binding	enables	IEA	InterPro:IPR000898\|InterPro:IPR037217	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ido1	Rat	indoleamine 2,3-dioxygenase activity		IDA		2290543		RGD
Ido1	Rat	indoleamine 2,3-dioxygenase activity	enables	IEA	EC:1.13.11.52	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ido1	Rat	indoleamine 2,3-dioxygenase activity	enables	IBA	MGI:2142489\|PANTHER:PTN002009580\|RGD:619989\|SGD:S000003839\|UniProtKB:P14902\|UniProtKB:Q6ZQW0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ido1	Rat	indoleamine 2,3-dioxygenase activity	enables	IEA	RHEA:14189	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Ido1	Rat	indoleamine 2,3-dioxygenase activity	enables	ISO	RGD:1346818	1624291	PMID:25310899	RGD	PMID:25310899
Ido1	Rat	indoleamine 2,3-dioxygenase activity	enables	IEA	UniProtKB:P14902\|ensembl:ENSP00000430950	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	indoleamine 2,3-dioxygenase activity		IDA		2290313		RGD
Ido1	Rat	indoleamine 2,3-dioxygenase activity		IDA		2290190		RGD
Ido1	Rat	metal ion binding	enables	IEA	UniRule:UR001933754	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ido1	Rat	metal ion binding	enables	IEA	InterPro:IPR037217	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ido1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ido1	Rat	oxidoreductase activity	enables	IEA	UniProtKB-KW:KW-0560	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ido1	Rat	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	enables	IEA	ARBA:ARBA00027642	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Ido1	Rat	oxygen binding		IDA		2290190		RGD
Ido1	Rat	protein binding	enables	ISO	RGD:731346	1624291	UniProtKB:P35235 PMID:21804557	RGD	PMID:21804557
Ido1	Rat	tryptophan 2,3-dioxygenase activity	enables	IEA	UniProtKB:P28776\|ensembl:ENSMUSP00000033956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ido1	Rat	tryptophan 2,3-dioxygenase activity	enables	ISO	RGD:731346	1624291	PMID:11751753	RGD	PMID:11751753
Ido1	Rat	tryptophan 2,3-dioxygenase activity	enables	IBA	MGI:96416\|PANTHER:PTN002009609	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ido1	Rat	tryptophan 2,3-dioxygenase activity	enables	IEA	RHEA:24536	1600115	GO_REF:0000116	RHEA	GO_REF:0000116

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	kynurenine metabolic pathway		ISO	RGD:1346818	11062165		RGD
Ido1	Rat	kynurenine metabolic pathway		ISO	RGD:1346818	39939073		RGD
Ido1	Rat	kynurenine metabolic pathway		ISO	RGD:1346818	11081068		RGD
Ido1	Rat	tryptophan metabolic pathway		IDA		2290190		RGD
Ido1	Rat	tryptophan metabolic pathway		IDA		2290313		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	tryptophan metabolic pathway		ISO	RGD:1346818	10402751		SMPDB	SMP:00063

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ido1	Rat	sleeping sickness pathway		IEA		6907045		KEGG	rno:05143
Ido1	Rat	tryptophan metabolic pathway		IEA		6907045		KEGG	rno:00380

BioCyc Pathways

L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde

Disease Annotations Click to see Annotation Detail View

acquired immunodeficiency syndrome (ISO)

Acute Lung Injury (ISO)

Animal Toxoplasmosis (ISO)

B-lymphoblastic leukemia/lymphoma (ISO)

Breast Neoplasms (ISO)

chlamydia (ISO)

Chronic Hepatitis B (ISO)

Chronic Hepatitis C (ISO)

Cognitive Dysfunction (ISO)

dengue disease (ISO)

eczema herpeticum (ISO)

endometriosis (ISO)

Endotoxemia (ISO)

Experimental Liver Cirrhosis (ISO)

hemophagocytic lymphohistiocytosis (ISO)

Inflammation (ISO)

Neoplasm Recurrence, Local (ISO)

neurodegenerative disease (ISO)

obesity (ISO)

paracoccidioidomycosis (ISO)

Pneumococcal Meningitis (ISO)

pneumonic tularemia (ISO)

pre-eclampsia (ISS)

pulmonary tuberculosis (ISO)

Salmonella Infections, Animal (ISO)

Sepsis (ISO)

shigellosis (ISO)

Streptococcus pneumonia (ISO)

swine influenza (ISO)

Systemic Juvenile Rheumatoid Arthritis (ISO)

toxic shock syndrome (ISO)

viral encephalitis (ISO)

Viral Myocarditis (ISO)

vulvovaginal candidiasis (ISO)

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-amphetamine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-tribromophenol (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

3',5'-cyclic AMP (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

5-aza-2'-deoxycytidine (ISO)

acetylsalicylic acid (ISO)

aconitic acid (ISO)

acyclovir (ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

anthranilic acid (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

bazedoxifene (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

beta-D-fructofuranose 1,6-bisphosphate (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

curcumin (ISO)

cyclophosphamide (EXP)

D-fructofuranose 1,6-bisphosphate (ISO)

D-glucopyranose 6-phosphate (ISO)

D-glucose (ISO)

decabromodiphenyl ether (ISO)

dextran sulfate (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

fumaric acid (ISO)

gadodiamide hydrate (ISO)

glucose (ISO)

glycerol 1-phosphate (ISO)

hexachlorobenzene (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

Indeno[1,2,3-cd]pyrene (ISO)

indirubin-3'-monoxime (ISO)

indole-3-methanol (ISO)

indolin-2-one (ISO)

keto-D-fructose 1,6-bisphosphate (ISO)

kynurenine (ISO)

L-tryptophan (ISO)

lasofoxifene (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

lithium atom (ISO)

lithium chloride (ISO)

lithium hydride (ISO)

malathion (ISO)

malic acid (ISO)

medroxyprogesterone acetate (ISO)

muramyl dipeptide (ISO)

N-nitrosodiethylamine (EXP)

neopterin (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nitric oxide (ISO)

nitroglycerin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorododecanoic acid (EXP)

phenethyl caffeate (EXP)

PhIP (EXP)

pirinixic acid (ISO)

poly(I:C) (ISO)

quercetin (EXP,ISO)

raloxifene (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

Salinomycin (ISO)

SB 431542 (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

succinic acid (ISO)

sulfasalazine (ISO)

temozolomide (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

vinclozolin (EXP)

XL147 (ISO)

zearalenone (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' NAD+ biosynthetic process from L-tryptophan (IBA)

immune system process (IEA)

inflammatory response (IEA,ISO)

kynurenic acid biosynthetic process (IEA,ISO)

L-tryptophan catabolic process (IEA)

L-tryptophan catabolic process to kynurenine (IBA,IDA,IEA,ISO)

multicellular organismal response to stress (IEA,ISO)

negative regulation of activated T cell proliferation (IEA,ISO)

negative regulation of interleukin-10 production (IEA,ISO)

negative regulation of T cell apoptotic process (IEA,ISO)

negative regulation of T cell proliferation (IEA,ISO)

positive regulation of apoptotic process (IEA,ISO)

positive regulation of chronic inflammatory response (IEA,ISO)

positive regulation of interleukin-12 production (IEA,ISO)

positive regulation of T cell apoptotic process (IEA,ISO)

positive regulation of T cell tolerance induction (IEA,ISO)

positive regulation of type 2 immune response (IEA,ISO)

quinolinate biosynthetic process (IEA,ISO)

regulation of activated T cell proliferation (ISO)

response to lipopolysaccharide (IEA,ISO)

swimming behavior (IEA,ISO)

T cell proliferation (IEA,ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (IEA)

smooth muscle contractile fiber (IEA,ISO)

stereocilium bundle (IEA,ISO)

Molecular Function

amino acid binding (IDA)

dioxygenase activity (IEA)

heme binding (IEA)

indoleamine 2,3-dioxygenase activity (IBA,IDA,IEA,ISO)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (IEA)

oxygen binding (IDA)

protein binding (ISO)

tryptophan 2,3-dioxygenase activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

kynurenine metabolic pathway (ISO)

sleeping sickness pathway (IEA)

tryptophan metabolic pathway (IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Tolerogenic Plasmacytoid Dendritic Cells Control Paracoccidioides brasiliensis Infection by Inducting Regulatory T Cells in an IDO-Dependent Manner.	Araújo EF, etal., PLoS Pathog. 2016 Dec 19;12(12):e1006115. doi: 10.1371/journal.ppat.1006115. eCollection 2016 Dec.
2.	Aryl hydrocarbon receptor control of a disease tolerance defence pathway.	Bessede A, etal., Nature. 2014 Jul 10;511(7508):184-90. doi: 10.1038/nature13323.
3.	Changes in kynurenic, anthranilic, and quinolinic acid concentrations in rat brain tissue during development.	Cannazza G, etal., Neurochem Res. 2001 May;26(5):511-4.
4.	Tryptophan metabolism to kynurenine is a potential novel contributor to hypotension in human sepsis.	Changsirivathanathamrong D, etal., Crit Care Med. 2011 Dec;39(12):2678-83. doi: 10.1097/CCM.0b013e31822827f2.
5.	Tryptophan catabolism reflects disease activity in human tuberculosis.	Collins JM, etal., JCI Insight. 2020 May 21;5(10). pii: 137131. doi: 10.1172/jci.insight.137131.
6.	Comparative effects of oxygen on indoleamine 2,3-dioxygenase and tryptophan 2,3-dioxygenase of the kynurenine pathway.	Dang Y, etal., Free Radic Biol Med. 2000 Feb 15;28(4):615-24.
7.	IL-22 and IDO1 affect immunity and tolerance to murine and human vaginal candidiasis.	De Luca A, etal., PLoS Pathog. 2013;9(7):e1003486. doi: 10.1371/journal.ppat.1003486. Epub 2013 Jul 11.
8.	LPS-conditioned dendritic cells confer endotoxin tolerance contingent on tryptophan catabolism.	Fallarino F, etal., Immunobiology. 2015 Feb;220(2):315-21. doi: 10.1016/j.imbio.2014.09.017. Epub 2014 Sep 28.
9.	Drug analog inhibition of indoleamine 2,3-dioxygenase (IDO) activity modifies pattern recognition receptor expression and proinflammatory cytokine responses early during influenza virus infection.	Fox JM, etal., J Leukoc Biol. 2014 Sep;96(3):447-52. doi: 10.1189/jlb.3AB0114-046RR. Epub 2014 May 5.
10.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.	Neopterin levels and Kyn/Trp ratios were significantly increased in dengue virus patients and subsequently decreased after recovery.	Geisler S, etal., Int J Infect Dis. 2020 Feb;91:162-168. doi: 10.1016/j.ijid.2019.12.005. Epub 2019 Dec 9.
12.	IDO1 depletion induces an anti-inflammatory response in macrophages in mice with chronic viral myocarditis.	Guo G, etal., Cell Cycle. 2019 Oct;18(20):2598-2613. doi: 10.1080/15384101.2019.1652471. Epub 2019 Aug 15.
13.	Blockade of indoleamine 2,3-dioxygenase reduces mortality from peritonitis and sepsis in mice by regulating functions of CD11b+ peritoneal cells.	Hoshi M, etal., Infect Immun. 2014 Nov;82(11):4487-95. doi: 10.1128/IAI.02113-14. Epub 2014 Aug 11.
14.	Induction and role of indoleamine 2,3 dioxygenase in mouse models of influenza a virus infection.	Huang L, etal., PLoS One. 2013 Jun 13;8(6):e66546. doi: 10.1371/journal.pone.0066546. Print 2013.
15.	Indoleamine 2,3-dioxygenase 1 deletion promotes Theiler's virus-induced seizures in C57BL/6J mice.	Juda MB, etal., Epilepsia. 2019 Apr;60(4):626-635. doi: 10.1111/epi.14675. Epub 2019 Feb 15.
16.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
17.	Asp274 and his346 are essential for heme binding and catalytic function of human indoleamine 2,3-dioxygenase.	Littlejohn TK, etal., J Biol Chem 2003 Aug 8;278(32):29525-31. Epub 2003 May 24.
18.	The kynurenine pathway and neurodegenerative disease.	Maddison DC and Giorgini F, Semin Cell Dev Biol. 2015 Apr;40:134-41. doi: 10.1016/j.semcdb.2015.03.002. Epub 2015 Mar 12.
19.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
20.	Epidermal Growth Factor Receptor-Responsive Indoleamine 2,3-Dioxygenase Confers Immune Homeostasis During Shigella flexneri Infection.	Mukherjee T, etal., J Infect Dis. 2019 May 5;219(11):1841-1851. doi: 10.1093/infdis/jiz009.
21.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.	Platelet-activating Factor Mediates Endotoxin Tolerance by Regulating Indoleamine 2,3-Dioxygenase-dependent Expression of the Suppressor of Cytokine Signaling 3.	Noh KT, etal., J Biol Chem. 2017 Feb 24;292(8):3290-3298. doi: 10.1074/jbc.M116.764464. Epub 2017 Jan 11.
23.	Enzymatic studies on tryptophan metabolism disorder in rats chronically exposed to carbon disulfide.	Okayama A, etal., Toxicol Appl Pharmacol. 1988 Jul;94(3):356-61.
24.	Indoleamine 2,3-dioxygenase 1 is a lung-specific innate immune defense mechanism that inhibits growth of Francisella tularensis tryptophan auxotrophs.	Peng K and Monack DM, Infect Immun. 2010 Jun;78(6):2723-33. doi: 10.1128/IAI.00008-10. Epub 2010 Apr 12.
25.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
26.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
27.	IDO1 Deficiency Does Not Affect Disease in Mouse Models of Systemic Juvenile Idiopathic Arthritis and Secondary Hemophagocytic Lymphohistiocytosis.	Put K, etal., PLoS One. 2016 Feb 25;11(2):e0150075. doi: 10.1371/journal.pone.0150075. eCollection 2016.
28.	GOA pipeline	RGD automated data pipeline
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	Synergistic transcriptional activation of indoleamine dioxygenase by IFN-gamma and tumor necrosis factor-alpha.	Robinson CM, etal., J Interferon Cytokine Res 2003 Aug;23(8):413-21.
31.	Indolamine 2,3-dioxygenase expression by monocytes and dendritic cell populations in hepatitis C patients.	Schulz S, etal., Clin Exp Immunol. 2015 Jun;180(3):484-98. doi: 10.1111/cei.12586.
32.	Exaggerated IDO1 expression and activity in Langerhans cells from patients with atopic dermatitis upon viral stimulation: a potential predictive biomarker for high risk of Eczema herpeticum.	Staudacher A, etal., Allergy. 2015 Nov;70(11):1432-9. doi: 10.1111/all.12699. Epub 2015 Sep 2.
33.	The kynurenine pathway contributes to long-term neuropsychological changes in experimental pneumococcal meningitis.	Too LK, etal., Behav Brain Res. 2014 Aug 15;270:179-95. doi: 10.1016/j.bbr.2014.05.018. Epub 2014 May 17.
34.	Indoleamine 2,3-Dioxygenase Activity During Acute Toxoplasmosis and the Suppressed T Cell Proliferation in Mice.	Ufermann CM, etal., Front Cell Infect Microbiol. 2019 Jun 5;9:184. doi: 10.3389/fcimb.2019.00184. eCollection 2019.
35.	Indoleamine 2,3-Dioxygenase Activity in Chlamydia muridarum and Chlamydia pneumoniae Infected Mouse Lung Tissues.	Virok DP, etal., Front Cell Infect Microbiol. 2019 Jun 12;9:192. doi: 10.3389/fcimb.2019.00192. eCollection 2019.
36.	Role of indoleamine 2,3-dioxygenase in health and disease.	Yeung AW, etal., Clin Sci (Lond). 2015 Oct;129(7):601-72. doi: 10.1042/CS20140392.
37.	Indoleamine 2,3-dioxygenase 1 deficiency attenuates CCl4-induced fibrosis through Th17 cells down-regulation and tryptophan 2,3-dioxygenase compensation.	Zhong W, etal., Oncotarget. 2017 Jun 20;8(25):40486-40500. doi: 10.18632/oncotarget.17119.
38.	High expression of IDO1 and TGF-β1 during recurrence and post infection clearance with Chlamydia trachomatis, are independent of host IFN-γ response.	Ziklo N, etal., BMC Infect Dis. 2019 Mar 4;19(1):218. doi: 10.1186/s12879-019-3843-4.

Additional References at PubMed

PMID:2419335	PMID:9712583	PMID:11751753	PMID:16319139	PMID:16477023	PMID:16688932	PMID:17645734	PMID:17671174	PMID:17868070	PMID:18077788	PMID:18436652	PMID:18475196
PMID:18480171	PMID:19177450	PMID:19234212	PMID:19234218	PMID:19283707	PMID:19602041	PMID:19741271	PMID:19935463	PMID:19944758	PMID:22172881	PMID:22424783	PMID:22454246
PMID:22751107	PMID:23607691	PMID:25310899	PMID:25498102	PMID:25829217	PMID:26506443	PMID:26636969	PMID:27366867	PMID:27870896	PMID:27994058	PMID:28118532	PMID:30736955
PMID:36879035

Genomics

Comparative Map Data

Ido1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	74,133,259 - 74,145,328 (+)	NCBI		GRCr8
mRatBN7.2	16	67,430,654 - 67,442,726 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	67,430,578 - 67,442,730 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	72,707,823 - 72,719,592 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	76,112,135 - 76,124,005 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	71,361,330 - 71,373,199 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	72,216,326 - 72,228,098 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	72,216,326 - 72,228,098 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	71,866,330 - 71,878,339 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	71,866,340 - 71,878,373 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	71,866,604 - 71,878,638 (+)	NCBI
Celera	16	65,330,156 - 65,341,814 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

IDO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	39,913,891 - 39,928,790 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	39,902,275 - 39,928,790 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	39,771,410 - 39,786,309 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	39,890,485 - 39,905,107 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	39,890,484 - 39,905,102	NCBI
Celera	8	38,723,061 - 38,737,682 (+)	NCBI		Celera
Cytogenetic Map	8	p11.21	NCBI
HuRef	8	38,304,038 - 38,319,017 (+)	NCBI		HuRef
CHM1_1	8	39,817,930 - 39,832,909 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	40,190,729 - 40,205,625 (+)	NCBI		T2T-CHM13v2.0

Ido1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	25,074,148 - 25,086,987 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	25,074,152 - 25,087,025 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	24,584,133 - 24,596,952 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	24,584,136 - 24,597,009 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	25,694,613 - 25,707,481 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	26,049,686 - 26,062,554 (-)	NCBI		MGSCv36	mm8
Celera	8	26,068,313 - 26,081,132 (-)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	12.76	NCBI

Ido1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955536	2,943,611 - 2,955,829 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955536	2,944,770 - 2,955,829 (-)	NCBI	ChiLan1.0	ChiLan1.0

IDO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	58,370,241 - 58,385,003 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	34,087,337 - 34,102,106 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	39,108,310 - 39,123,611 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	36,606,721 - 36,632,371 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	36,617,312 - 36,632,352 (+)	Ensembl	panpan1.1		panPan2

IDO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	25,391,759 - 25,407,161 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	25,391,754 - 25,407,048 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	25,901,596 - 25,916,857 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	27,218,925 - 27,234,204 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	27,218,820 - 27,234,153 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	25,516,922 - 25,532,182 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	26,072,694 - 26,087,946 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	26,131,508 - 26,146,796 (-)	NCBI		UU_Cfam_GSD_1.0

Ido1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	48,593,856 - 48,608,521 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936843	657,979 - 672,700 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936843	658,058 - 672,662 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IDO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	9,245,196 - 9,260,473 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	9,245,283 - 9,260,140 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	10,913,978 - 10,928,837 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IDO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	37,930,910 - 37,950,790 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	37,930,562 - 37,946,505 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	3,981,103 - 3,996,711 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ido1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624780	3,685,069 - 3,697,474 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624780	3,684,941 - 3,697,506 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ido1
237 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	18
Count of miRNA genes:	18
Interacting mature miRNAs:	18
Transcripts:	ENSRNOT00000051363
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	12	12	15	19	19	1	45	35	7	1	31	19

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_023973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF312699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN197607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051363 ⟹ ENSRNOP00000050320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	67,430,578 - 67,442,730 (+)	Ensembl
Rnor_6.0 Ensembl	16	72,216,326 - 72,228,098 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117293 ⟹ ENSRNOP00000078965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	67,430,578 - 67,442,730 (+)	Ensembl

RefSeq Acc Id:

NM_023973 ⟹ NP_076463

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	74,133,259 - 74,145,328 (+)	NCBI
mRatBN7.2	16	67,430,654 - 67,442,726 (+)	NCBI
Rnor_6.0	16	72,216,326 - 72,228,098 (+)	NCBI
Rnor_5.0	16	71,866,330 - 71,878,339 (+)	NCBI
RGSC_v3.4	16	71,866,340 - 71,878,373 (+)	RGD
Celera	16	65,330,156 - 65,341,814 (+)	RGD

Sequence:

show sequence

ATGCCTCACAGTCAAATATCTCCTGCAGAAGGCTCTAGAAGGATCCTTGAAGAATACCACATAG
ATGAAGATGTGGGCTTTGCTCTACCACATCCACTGGAGGAGCTGCCTGATACGTACAGACCTTG
GATCCTTGTGGCTAGAAATCTGCCTAAGCTGATTGAGAATGGGAAGCTCCGAGAAGAAGTCGAG
AAGCTGCCCACACTGCGCACCGAAGAACTGAGGGGACACAGGTTACAGCGCCTGGCACATTTGG
CCCTGGGGTACATCACCATGGCGTATGTGTGGAACCGAGGGGATGATGATATTCGAAAGGTGCT
GCCCCGCAATCTTGCCGTTCCCTACTGCGAGCTCTCGGAGAAGCTGGGGCTGCCTCCCATTCTG
TCTTACGCAGACTGCGTCCTGGCAAACTGGAAGAAAAAGGACCCCAATGGGCCCATGACATACG
AGAACATGGACATTCTGTTCTCGTTTCCTGGTGGGGACTGCGATAAAGGCTTCTTCCTGGTCTC
TCTAATGGTGGAAATCGCAGCTTCTCCTGCAATCAAAGCAATTCCTACTGTATCCAGTGCAGTA
GAGCATCAAGACCCGAAAGCACTGGAGAAGGCACTGTGTAGTATAGCTGCCAGTCTGGAGAAAG
CCAAGGAAATTTTTAAGAGGATGCGTGACTTCGTGGATCCAGACACCTTTTTCCACGTTCTTCG
CATATATTTGTCTGGTTGGAAGGGCAACCCTAAGCTGCCGGAGGGTCTGCTGTACGAGGGCGTC
TGGGACACCCCCAAAAAATTTTCAGGGGGCAGTGCAGGCCAGAGCAGCATCTTTCAGAGTCTTG
ATGTCCTTCTGGGAATAAAGCATGACGTTGGTGAAGGATCTGCTGCAGAATTCCTCCAGGAAAT
GAGAGAGTACATGCCTCCAGCCCACCGGAACTTCCTCTCCTCCTTAGAGTCAGCTCCCCCAGTC
CGTGAGTTTGTCATTTTAAGACGCAATGAAGACTTGAAGGAGGCTTATAATGAGTGTGTGAATG
GCCTGGTCTCCCTCAGAATGTTCCACCTCTCGATAGTAGATACTTACATTGTGAAGCCTTCGAA
GCAGAAGCCCATGGGTGGCCACAAGTCAGAAGAGCCCTCAAACACGGAAAACAGAGGGACTGGG
GGTACTGACGTCATGAATTTCCTGAGGAGTGTGAAAGATACAACCAAGAAAGCCCTTCTGAGTT
GGCCTTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_076463	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG30573	(Get FASTA)	NCBI Sequence Viewer
	EDM09039	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050320
GenBank Protein	Q9ERD9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_076463 ⟸ NM_023973

- UniProtKB:

Q9ERD9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MPHSQISPAEGSRRILEEYHIDEDVGFALPHPLEELPDTYRPWILVARNLPKLIENGKLREEVE
KLPTLRTEELRGHRLQRLAHLALGYITMAYVWNRGDDDIRKVLPRNLAVPYCELSEKLGLPPIL
SYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLMVEIAASPAIKAIPTVSSAV
EHQDPKALEKALCSIAASLEKAKEIFKRMRDFVDPDTFFHVLRIYLSGWKGNPKLPEGLLYEGV
WDTPKKFSGGSAGQSSIFQSLDVLLGIKHDVGEGSAAEFLQEMREYMPPAHRNFLSSLESAPPV
REFVILRRNEDLKEAYNECVNGLVSLRMFHLSIVDTYIVKPSKQKPMGGHKSEEPSNTENRGTG
GTDVMNFLRSVKDTTKKALLSWP

hide sequence

Ensembl Acc Id:

ENSRNOP00000050320 ⟸ ENSRNOT00000051363

Ensembl Acc Id:

ENSRNOP00000078965 ⟸ ENSRNOT00000117293

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ERD9-F1-model_v2	AlphaFold	Q9ERD9	1-407	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619989	AgrOrtholog
BioCyc Gene	G2FUF-10943	BioCyc
BioCyc Pathway	PWY-5651 [L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde]	BioCyc
BioCyc Pathway Image	PWY-5651	BioCyc
Ensembl Genes	ENSRNOG00000031189	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000051363	ENTREZGENE
Gene3D-CATH	1.20.58.480	UniProtKB/Swiss-Prot
InterPro	Indolamine_dOase	UniProtKB/Swiss-Prot
	Trp/Indoleamine_2_3_dOase-like	UniProtKB/Swiss-Prot
KEGG Report	rno:66029	UniProtKB/Swiss-Prot
NCBI Gene	66029	ENTREZGENE
PANTHER	INDOLEAMINE 2,3-DIOXYGENASE 1	UniProtKB/Swiss-Prot
	PTHR28657	UniProtKB/Swiss-Prot
Pfam	IDO	UniProtKB/Swiss-Prot
PhenoGen	Ido1	PhenoGen
PROSITE	IDO_1	UniProtKB/Swiss-Prot
	IDO_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000031189	RatGTEx
Superfamily-SCOP	SSF140959	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZM07_RAT	UniProtKB/TrEMBL
	F1LMC9_RAT	UniProtKB/TrEMBL
	I23O1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-04	Ido1	indoleamine 2,3-dioxygenase 1	Indo	indoleamine-pyrrole 2,3 dioxygenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Indo	indoleamine-pyrrole 2,3 dioxygenase		indoleamine 2,3-dioxygenase	Name updated	1299863	APPROVED
2004-09-10	Indo	indoleamine 2,3-dioxygenase	Ido		Symbol and Name updated	1299863	APPROVED
2002-08-07	Ido	indoleamine 2,3-dioxygenase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways