Advanced Search (OLGA)

Gene: Alcam (activated leukocyte cell adhesion molecule) Rattus norvegicus

Analyze

Symbol:

Alcam

Name:

activated leukocyte cell adhesion molecule

RGD ID:

619972

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in axon extension involved in axon guidance; heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules; and retinal ganglion cell axon guidance. Predicted to act upstream of or within motor neuron axon guidance. Predicted to be located in several cellular components, including external side of plasma membrane; immunological synapse; and neuronal cell body. Predicted to be part of T cell receptor complex. Predicted to be active in plasma membrane. Orthologous to human ALCAM (activated leukocyte cell adhesion molecule); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4',5,5'-hexachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CD166 antigen; HB2; KG-CAM; SB-10 antigen

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	61,804,932 - 62,005,250 (+)	NCBI		GRCr8
mRatBN7.2	11	48,336,123 - 48,536,296 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	48,336,169 - 48,537,954 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	57,110,123 - 57,309,926 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	49,771,802 - 49,971,585 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	48,895,907 - 49,095,677 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	50,780,735 - 50,985,083 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	50,781,127 - 50,985,083 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	53,964,563 - 54,165,636 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	49,424,243 - 49,630,071 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	49,481,831 - 49,687,660 (+)	NCBI
Celera	11	48,024,575 - 48,218,199 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alcam	Rat	COVID-19		ISO	RGD:733283	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744
Alcam	Rat	Experimental Mammary Neoplasms		IEP		2306898	mRNA:increased expression:mammary gland (rat)	RGD

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alcam	Rat	Animal Mammary Neoplasms		ISO	RGD:733283	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16316942
Alcam	Rat	basal cell carcinoma		ISO	RGD:733283	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:36428691
Alcam	Rat	carcinoma		ISO	RGD:733283	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16316942
Alcam	Rat	Experimental Mammary Neoplasms		ISO	RGD:733283	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16316942

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alcam	Rat	1-nitropyrene	increases expression	ISO	RGD:733283	6480464	1-nitropyrene results in increased expression of ALCAM mRNA	CTD	PMID:19041380
Alcam	Rat	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of ALCAM mRNA	CTD	PMID:20170705
Alcam	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of ALCAM mRNA	CTD	PMID:15834898\|PMID:17557909
Alcam	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:733284	6480464	Ethinyl Estradiol results in increased expression of ALCAM mRNA	CTD	PMID:17942748
Alcam	Rat	17beta-estradiol	affects expression	ISO	RGD:733283	6480464	Estradiol affects the expression of ALCAM mRNA	CTD	PMID:14699072
Alcam	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of ALCAM mRNA	CTD	PMID:32145629
Alcam	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of ALCAM mRNA	CTD	PMID:26496021
Alcam	Rat	17beta-estradiol	decreases expression	ISO	RGD:733283	6480464	Estradiol results in decreased expression of ALCAM mRNA	CTD	PMID:19619570\|PMID:21185374
Alcam	Rat	17beta-estradiol	increases expression	ISO	RGD:733284	6480464	Estradiol results in increased expression of ALCAM mRNA	CTD	PMID:15289156
Alcam	Rat	17beta-estradiol	multiple interactions	ISO	RGD:733283	6480464	[Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of ALCAM mRNA; Raloxifene Hydrochloride inhibits the more ...	CTD	PMID:19619570\|PMID:21185374
Alcam	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	EXP		6480464	[3,4,5,3',4'-pentachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl] results in decreased expression of ALCAM mRNA	CTD	PMID:16984957
Alcam	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:733284	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of ALCAM mRNA	CTD	PMID:30294300
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:733283	6480464	[Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of ALCAM mRNA	CTD	PMID:19619570
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of ALCAM mRNA	CTD	PMID:34747641
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:733284	6480464	Tetrachlorodibenzodioxin affects the expression of ALCAM mRNA	CTD	PMID:21570461\|PMID:24680724
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ALCAM mRNA	CTD	PMID:21215274\|PMID:32109520
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:733283	6480464	Tetrachlorodibenzodioxin affects the expression of ALCAM mRNA	CTD	PMID:22298810
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:733284	6480464	Tetrachlorodibenzodioxin results in increased expression of ALCAM mRNA	CTD	PMID:19684285\|PMID:19770486\|PMID:21041162
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:733284	6480464	Tetrachlorodibenzodioxin results in decreased expression of ALCAM mRNA	CTD	PMID:19465110\|PMID:19933214\|PMID:28922406
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:733283	6480464	Tetrachlorodibenzodioxin results in decreased expression of ALCAM mRNA	CTD	PMID:19619570\|PMID:19684285
Alcam	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:733283	6480464	Tetrachlorodibenzodioxin results in increased expression of ALCAM mRNA	CTD	PMID:19684285
Alcam	Rat	2,4-diaminotoluene	increases expression	ISO	RGD:733284	6480464	2,4-diaminotoluene results in increased expression of ALCAM mRNA	CTD	PMID:20713471
Alcam	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:733284	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of ALCAM mRNA	CTD	PMID:38648751
Alcam	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of ALCAM mRNA	CTD	PMID:21346803
Alcam	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of ALCAM mRNA	CTD	PMID:21346803
Alcam	Rat	2-bromohexadecanoic acid	multiple interactions	ISO	RGD:733283	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Alcam	Rat	3,3',4,4',5-pentachlorobiphenyl	multiple interactions	EXP		6480464	[3,4,5,3',4'-pentachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl] results in decreased expression of ALCAM mRNA	CTD	PMID:16984957
Alcam	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of ALCAM mRNA	CTD	PMID:20959002
Alcam	Rat	3,3',5,5'-tetrabromobisphenol A	increases expression	ISO	RGD:733284	6480464	tetrabromobisphenol A results in increased expression of ALCAM mRNA	CTD	PMID:25172293
Alcam	Rat	3,4-methylenedioxymethamphetamine	decreases expression	EXP		6480464	N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of ALCAM mRNA	CTD	PMID:30071829
Alcam	Rat	3-methylcholanthrene	increases expression	ISO	RGD:733284	6480464	Methylcholanthrene results in increased expression of ALCAM mRNA	CTD	PMID:20713471
Alcam	Rat	3H-1,2-dithiole-3-thione	decreases expression	EXP		6480464	1,2-dithiol-3-thione results in decreased expression of ALCAM mRNA	CTD	PMID:19162173
Alcam	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:733284	6480464	bisphenol S results in increased expression of ALCAM mRNA	CTD	PMID:30951980
Alcam	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Alcam	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:733284	6480464	bisphenol S results in decreased expression of ALCAM mRNA	CTD	PMID:39298647
Alcam	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:733284	6480464	Fenretinide results in decreased expression of ALCAM mRNA	CTD	PMID:28973697
Alcam	Rat	5-fluorouracil	affects response to substance	ISO	RGD:733283	6480464	ALCAM protein affects the susceptibility to Fluorouracil	CTD	PMID:15352031
Alcam	Rat	5-fluorouracil	decreases expression	ISO	RGD:733283	6480464	Fluorouracil results in decreased expression of ALCAM protein	CTD	PMID:15352031
Alcam	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of ALCAM mRNA	CTD	PMID:30047161
Alcam	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of ALCAM mRNA	CTD	PMID:31881176
Alcam	Rat	aflatoxin B1	decreases methylation	ISO	RGD:733283	6480464	Aflatoxin B1 results in decreased methylation of ALCAM gene	CTD	PMID:27153756
Alcam	Rat	aldehydo-D-glucose	multiple interactions	ISO	RGD:733284	6480464	fucoxanthin inhibits the reaction [Glucose results in increased expression of ALCAM mRNA]	CTD	PMID:33448797
Alcam	Rat	aldehydo-D-glucose	increases expression	ISO	RGD:733284	6480464	Glucose results in increased expression of ALCAM mRNA	CTD	PMID:33448797
Alcam	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:733283	6480464	Tretinoin results in increased expression of ALCAM mRNA	CTD	PMID:21934132
Alcam	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ALCAM mRNA	CTD	PMID:35163327
Alcam	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of ALCAM mRNA	CTD	PMID:16483693
Alcam	Rat	antirheumatic drug	decreases expression	ISO	RGD:733283	6480464	Antirheumatic Agents results in decreased expression of ALCAM mRNA	CTD	PMID:24449571
Alcam	Rat	aristolochic acid A	decreases expression	ISO	RGD:733283	6480464	aristolochic acid I results in decreased expression of ALCAM mRNA; aristolochic acid I results in more ...	CTD	PMID:33212167
Alcam	Rat	Aroclor 1254	decreases expression	EXP		6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of ALCAM mRNA	CTD	PMID:18178546
Alcam	Rat	arsane	multiple interactions	ISO	RGD:733283	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ALCAM more ...	CTD	PMID:39836092
Alcam	Rat	arsenic atom	multiple interactions	ISO	RGD:733283	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ALCAM more ...	CTD	PMID:39836092
Alcam	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of ALCAM gene	CTD	PMID:35440735
Alcam	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:733284	6480464	Benzo(a)pyrene results in decreased expression of ALCAM mRNA	CTD	PMID:19770486
Alcam	Rat	benzo[a]pyrene	increases expression	ISO	RGD:733283	6480464	Benzo(a)pyrene results in increased expression of ALCAM protein	CTD	PMID:32717239
Alcam	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:733283	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of ALCAM mRNA	CTD	PMID:19150397
Alcam	Rat	benzoates	decreases expression	ISO	RGD:733283	6480464	Benzoates analog results in decreased expression of ALCAM mRNA	CTD	PMID:29472718
Alcam	Rat	bisphenol A	affects expression	ISO	RGD:733283	6480464	bisphenol A affects the expression of ALCAM mRNA	CTD	PMID:20170705
Alcam	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ALCAM mRNA	CTD	PMID:30816183\|PMID:34947998\|PMID:38750585
Alcam	Rat	bisphenol A	increases expression	ISO	RGD:733284	6480464	bisphenol A results in increased expression of ALCAM mRNA	CTD	PMID:30951980\|PMID:38701888
Alcam	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ALCAM mRNA; bisphenol A results in increased expression more ...	CTD	PMID:24552547\|PMID:32145629
Alcam	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:26496021\|PMID:36041667
Alcam	Rat	bisphenol F	increases expression	ISO	RGD:733284	6480464	bisphenol F results in increased expression of ALCAM mRNA	CTD	PMID:30951980
Alcam	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Alcam	Rat	Brodifacoum	decreases expression	EXP		6480464	bromfenacoum results in decreased expression of ALCAM protein	CTD	PMID:28903499
Alcam	Rat	cadmium atom	increases expression	ISO	RGD:733284	6480464	Cadmium results in increased expression of ALCAM mRNA	CTD	PMID:24067728
Alcam	Rat	cadmium atom	multiple interactions	ISO	RGD:733283	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Alcam	Rat	cadmium dichloride	increases expression	ISO	RGD:733283	6480464	Cadmium Chloride results in increased expression of ALCAM mRNA	CTD	PMID:26472689
Alcam	Rat	cadmium dichloride	multiple interactions	ISO	RGD:733283	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Alcam	Rat	cannabidiol	decreases expression	ISO	RGD:733283	6480464	Cannabidiol results in decreased expression of ALCAM mRNA	CTD	PMID:27932991
Alcam	Rat	carbon nanotube	decreases secretion	ISO	RGD:733284	6480464	Nanotubes, Carbon results in decreased secretion of ALCAM protein	CTD	PMID:25598225
Alcam	Rat	carbon nanotube	decreases expression	ISO	RGD:733284	6480464	Nanotubes, Carbon analog results in decreased expression of ALCAM mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681\|PMID:25620056
Alcam	Rat	chlordecone	increases expression	ISO	RGD:733284	6480464	Chlordecone results in increased expression of ALCAM mRNA	CTD	PMID:33711761
Alcam	Rat	chloropicrin	increases expression	ISO	RGD:733283	6480464	chloropicrin results in increased expression of ALCAM mRNA	CTD	PMID:26352163
Alcam	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of ALCAM mRNA	CTD	PMID:18668222
Alcam	Rat	clobetasol	decreases expression	ISO	RGD:733284	6480464	Clobetasol results in decreased expression of ALCAM mRNA	CTD	PMID:27462272
Alcam	Rat	cocaine	increases expression	EXP		6480464	Cocaine results in increased expression of ALCAM mRNA	CTD	PMID:17898221
Alcam	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of ALCAM mRNA	CTD	PMID:30556269
Alcam	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of ALCAM mRNA	CTD	PMID:30556269
Alcam	Rat	coumestrol	decreases expression	ISO	RGD:733283	6480464	Coumestrol results in decreased expression of ALCAM mRNA	CTD	PMID:19167446
Alcam	Rat	curcumin	decreases expression	ISO	RGD:733283	6480464	Curcumin results in decreased expression of ALCAM mRNA	CTD	PMID:33539684
Alcam	Rat	cyclophosphamide	increases expression	ISO	RGD:733284	6480464	Cyclophosphamide results in increased expression of ALCAM mRNA	CTD	PMID:21041162
Alcam	Rat	cyclosporin A	affects expression	ISO	RGD:733284	6480464	Cyclosporine affects the expression of ALCAM mRNA	CTD	PMID:19770486
Alcam	Rat	cyclosporin A	decreases expression	ISO	RGD:733283	6480464	Cyclosporine results in decreased expression of ALCAM mRNA	CTD	PMID:25562108\|PMID:27989131
Alcam	Rat	D-glucose	multiple interactions	ISO	RGD:733284	6480464	fucoxanthin inhibits the reaction [Glucose results in increased expression of ALCAM mRNA]	CTD	PMID:33448797
Alcam	Rat	D-glucose	increases expression	ISO	RGD:733284	6480464	Glucose results in increased expression of ALCAM mRNA	CTD	PMID:33448797
Alcam	Rat	DDT	decreases expression	EXP		6480464	DDT results in decreased expression of ALCAM mRNA	CTD	PMID:30207508
Alcam	Rat	dexamethasone	increases expression	ISO	RGD:733284	6480464	Dexamethasone results in increased expression of ALCAM mRNA	CTD	PMID:21041162
Alcam	Rat	Dibutyl phosphate	affects expression	ISO	RGD:733283	6480464	di-n-butylphosphoric acid affects the expression of ALCAM mRNA	CTD	PMID:37042841
Alcam	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of ALCAM mRNA	CTD	PMID:21266533
Alcam	Rat	dibutyl phthalate	increases expression	ISO	RGD:733284	6480464	Dibutyl Phthalate results in increased expression of ALCAM mRNA	CTD	PMID:17361019\|PMID:21266533
Alcam	Rat	dicrotophos	decreases expression	ISO	RGD:733283	6480464	dicrotophos results in decreased expression of ALCAM mRNA	CTD	PMID:28302478
Alcam	Rat	diethylstilbestrol	increases expression	ISO	RGD:733284	6480464	Diethylstilbestrol results in increased expression of ALCAM mRNA	CTD	PMID:15289156
Alcam	Rat	dioxygen	multiple interactions	EXP		6480464	[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ...	CTD	PMID:33729688
Alcam	Rat	dioxygen	multiple interactions	ISO	RGD:733283	6480464	[Oxygen deficiency co-treated with Oxygen] results in decreased expression of ALCAM mRNA; ALCAM protein inhibits more ...	CTD	PMID:34995009
Alcam	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of ALCAM mRNA	CTD	PMID:21551480
Alcam	Rat	dorsomorphin	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Alcam	Rat	elemental selenium	decreases expression	ISO	RGD:733283	6480464	Selenium results in decreased expression of ALCAM mRNA	CTD	PMID:19244175
Alcam	Rat	enzyme inhibitor	multiple interactions	ISO	RGD:733283	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Alcam	Rat	epoxiconazole	increases expression	ISO	RGD:733284	6480464	epoxiconazole results in increased expression of ALCAM mRNA	CTD	PMID:35436446
Alcam	Rat	ethanol	multiple interactions	ISO	RGD:733284	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ALCAM mRNA	CTD	PMID:30517762
Alcam	Rat	folic acid	decreases expression	ISO	RGD:733284	6480464	Folic Acid results in decreased expression of ALCAM mRNA	CTD	PMID:25629700
Alcam	Rat	fonofos	increases methylation	ISO	RGD:733283	6480464	Fonofos results in increased methylation of ALCAM promoter	CTD	PMID:22847954
Alcam	Rat	fucoxanthin	multiple interactions	ISO	RGD:733284	6480464	fucoxanthin inhibits the reaction [Glucose results in increased expression of ALCAM mRNA]	CTD	PMID:33448797
Alcam	Rat	fumonisin B1	increases expression	ISO	RGD:733284	6480464	fumonisin B1 results in increased expression of ALCAM mRNA	CTD	PMID:16221962
Alcam	Rat	genistein	increases expression	ISO	RGD:733284	6480464	Genistein results in increased expression of ALCAM mRNA	CTD	PMID:15289156
Alcam	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of ALCAM mRNA	CTD	PMID:33387578
Alcam	Rat	glucose	increases expression	ISO	RGD:733284	6480464	Glucose results in increased expression of ALCAM mRNA	CTD	PMID:33448797
Alcam	Rat	glucose	multiple interactions	ISO	RGD:733284	6480464	fucoxanthin inhibits the reaction [Glucose results in increased expression of ALCAM mRNA]	CTD	PMID:33448797
Alcam	Rat	heptachlor	decreases expression	EXP		6480464	Heptachlor results in decreased expression of ALCAM mRNA	CTD	PMID:23153324
Alcam	Rat	inulin	multiple interactions	ISO	RGD:733284	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ALCAM mRNA	CTD	PMID:36331819
Alcam	Rat	isotretinoin	decreases expression	ISO	RGD:733283	6480464	Isotretinoin results in decreased expression of ALCAM mRNA	CTD	PMID:20436886
Alcam	Rat	ivermectin	decreases expression	ISO	RGD:733283	6480464	Ivermectin results in decreased expression of ALCAM protein	CTD	PMID:32959892
Alcam	Rat	lead diacetate	increases expression	ISO	RGD:733284	6480464	lead acetate results in increased expression of ALCAM mRNA	CTD	PMID:21829687
Alcam	Rat	lead(0)	affects splicing	ISO	RGD:733283	6480464	Lead affects the splicing of ALCAM mRNA	CTD	PMID:28903495
Alcam	Rat	medroxyprogesterone acetate	increases expression	ISO	RGD:733283	6480464	Medroxyprogesterone Acetate results in increased expression of ALCAM mRNA	CTD	PMID:18497975\|PMID:20843944
Alcam	Rat	mercury dibromide	increases expression	ISO	RGD:733283	6480464	mercuric bromide results in increased expression of ALCAM mRNA	CTD	PMID:26272509
Alcam	Rat	mercury dibromide	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Alcam	Rat	methidathion	increases expression	ISO	RGD:733284	6480464	methidathion results in increased expression of ALCAM mRNA	CTD	PMID:34813904
Alcam	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of ALCAM mRNA	CTD	PMID:30047161
Alcam	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of ALCAM gene	CTD	PMID:35440735
Alcam	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:733283	6480464	Methyl Methanesulfonate results in decreased expression of ALCAM mRNA	CTD	PMID:23649840
Alcam	Rat	methylmercury chloride	affects expression	ISO	RGD:733284	6480464	methylmercuric chloride affects the expression of ALCAM mRNA	CTD	PMID:21613230
Alcam	Rat	methylmercury chloride	decreases expression	ISO	RGD:733283	6480464	methylmercuric chloride results in decreased expression of ALCAM mRNA	CTD	PMID:28001369
Alcam	Rat	methylmercury chloride	increases expression	ISO	RGD:733283	6480464	methylmercuric chloride results in increased expression of ALCAM mRNA	CTD	PMID:23179753
Alcam	Rat	miconazole	decreases expression	ISO	RGD:733284	6480464	Miconazole results in decreased expression of ALCAM mRNA	CTD	PMID:27462272
Alcam	Rat	mitomycin C	affects response to substance	ISO	RGD:733283	6480464	ALCAM protein affects the susceptibility to Mitomycin	CTD	PMID:16217747
Alcam	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of ALCAM mRNA	CTD	PMID:21515302
Alcam	Rat	N(gamma)-nitro-L-arginine methyl ester	multiple interactions	ISO	RGD:733284	6480464	ALKBH5 protein promotes the reaction [NG-Nitroarginine Methyl Ester results in decreased expression of ALCAM protein]	CTD	PMID:34995009
Alcam	Rat	N(gamma)-nitro-L-arginine methyl ester	decreases expression	ISO	RGD:733284	6480464	NG-Nitroarginine Methyl Ester results in decreased expression of ALCAM protein	CTD	PMID:34995009
Alcam	Rat	N-acetyl-1,4-benzoquinone imine	affects response to substance	ISO	RGD:733283	6480464	ALCAM gene SNP affects the susceptibility to N-acetyl-4-benzoquinoneimine	CTD	PMID:21177773
Alcam	Rat	N-methyl-4-phenylpyridinium	decreases expression	ISO	RGD:733283	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of ALCAM mRNA	CTD	PMID:24810058
Alcam	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of ALCAM mRNA	CTD	PMID:28801915
Alcam	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:733284	6480464	Diethylnitrosamine results in increased expression of ALCAM mRNA	CTD	PMID:24535843
Alcam	Rat	nickel sulfate	increases expression	ISO	RGD:733283	6480464	nickel sulfate results in increased expression of ALCAM mRNA	CTD	PMID:16780908
Alcam	Rat	nimesulide	decreases expression	EXP		6480464	nimesulide results in decreased expression of ALCAM mRNA	CTD	PMID:24136188
Alcam	Rat	okadaic acid	decreases expression	ISO	RGD:733283	6480464	Okadaic Acid results in decreased expression of ALCAM mRNA	CTD	PMID:38832940
Alcam	Rat	ozone	multiple interactions	ISO	RGD:733284	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of ALCAM more ...	CTD	PMID:34911549
Alcam	Rat	panobinostat	increases expression	ISO	RGD:733283	6480464	panobinostat results in increased expression of ALCAM mRNA	CTD	PMID:26272509
Alcam	Rat	panobinostat	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Alcam	Rat	paracetamol	affects expression	ISO	RGD:733284	6480464	Acetaminophen affects the expression of ALCAM mRNA	CTD	PMID:17562736
Alcam	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of ALCAM mRNA	CTD	PMID:33387578
Alcam	Rat	paracetamol	increases expression	ISO	RGD:733284	6480464	Acetaminophen results in increased expression of ALCAM mRNA	CTD	PMID:29246445
Alcam	Rat	paracetamol	multiple interactions	ISO	RGD:733284	6480464	PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of ALCAM mRNA]	CTD	PMID:29246445
Alcam	Rat	paracetamol	decreases expression	ISO	RGD:733283	6480464	Acetaminophen results in decreased expression of ALCAM mRNA	CTD	PMID:21420995
Alcam	Rat	parathion	increases methylation	ISO	RGD:733283	6480464	Parathion results in increased methylation of ALCAM promoter	CTD	PMID:22847954
Alcam	Rat	perfluorooctane-1-sulfonic acid	decreases expression	EXP		6480464	perfluorooctane sulfonic acid results in decreased expression of ALCAM mRNA	CTD	PMID:18692542
Alcam	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:733284	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ALCAM mRNA	CTD	PMID:36331819
Alcam	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	RGD:733283	6480464	perfluorooctane sulfonic acid results in decreased expression of ALCAM mRNA	CTD	PMID:27153767
Alcam	Rat	perfluorooctanoic acid	decreases expression	EXP		6480464	perfluorooctanoic acid results in decreased expression of ALCAM mRNA	CTD	PMID:19162173
Alcam	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ALCAM mRNA	CTD	PMID:35163327
Alcam	Rat	phenobarbital	decreases expression	ISO	RGD:733284	6480464	Phenobarbital results in decreased expression of ALCAM mRNA	CTD	PMID:23091169
Alcam	Rat	phenylmercury acetate	increases expression	ISO	RGD:733283	6480464	Phenylmercuric Acetate results in increased expression of ALCAM mRNA	CTD	PMID:26272509
Alcam	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Alcam	Rat	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of ALCAM mRNA	CTD	PMID:19162173\|PMID:22484513
Alcam	Rat	pirinixic acid	decreases expression	ISO	RGD:733284	6480464	pirinixic acid results in decreased expression of ALCAM mRNA	CTD	PMID:23811191
Alcam	Rat	progesterone	increases expression	ISO	RGD:733283	6480464	Progesterone results in increased expression of ALCAM mRNA	CTD	PMID:18497975\|PMID:21795739
Alcam	Rat	propiconazole	decreases expression	ISO	RGD:733284	6480464	propiconazole results in decreased expression of ALCAM mRNA	CTD	PMID:21278054
Alcam	Rat	protein kinase inhibitor	multiple interactions	ISO	RGD:733283	6480464	Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of ALCAM mRNA]	CTD	PMID:28003376
Alcam	Rat	raloxifene	multiple interactions	ISO	RGD:733283	6480464	Raloxifene Hydrochloride inhibits the reaction [Estradiol results in decreased expression of ALCAM mRNA]	CTD	PMID:21185374
Alcam	Rat	resveratrol	multiple interactions	ISO	RGD:733283	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of ALCAM mRNA	CTD	PMID:23557933
Alcam	Rat	SB 431542	increases expression	ISO	RGD:733283	6480464	4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of ALCAM protein	CTD	PMID:25670856
Alcam	Rat	SB 431542	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Alcam	Rat	selenium atom	decreases expression	ISO	RGD:733283	6480464	Selenium results in decreased expression of ALCAM mRNA	CTD	PMID:19244175
Alcam	Rat	silver atom	increases expression	ISO	RGD:733284	6480464	Silver results in increased expression of ALCAM mRNA	CTD	PMID:27131904
Alcam	Rat	silver(0)	increases expression	ISO	RGD:733284	6480464	Silver results in increased expression of ALCAM mRNA	CTD	PMID:27131904
Alcam	Rat	sodium arsenate	increases expression	ISO	RGD:733284	6480464	sodium arsenate results in increased expression of ALCAM mRNA	CTD	PMID:21795629
Alcam	Rat	sodium arsenite	decreases expression	ISO	RGD:733283	6480464	sodium arsenite results in decreased expression of ALCAM mRNA; sodium arsenite results in decreased expression more ...	CTD	PMID:21925251\|PMID:38568856
Alcam	Rat	sodium arsenite	decreases expression	ISO	RGD:733284	6480464	sodium arsenite results in decreased expression of ALCAM mRNA	CTD	PMID:37682722
Alcam	Rat	sodium arsenite	multiple interactions	ISO	RGD:733283	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ALCAM more ...	CTD	PMID:39836092
Alcam	Rat	sodium fluoride	decreases expression	ISO	RGD:733284	6480464	Sodium Fluoride results in decreased expression of ALCAM protein	CTD	PMID:28918527
Alcam	Rat	succimer	multiple interactions	ISO	RGD:733284	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of ALCAM mRNA	CTD	PMID:21641980
Alcam	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of ALCAM mRNA	CTD	PMID:30047161
Alcam	Rat	sulforaphane	decreases expression	ISO	RGD:733283	6480464	sulforaphane results in decreased expression of ALCAM mRNA	CTD	PMID:31838189
Alcam	Rat	sunitinib	increases expression	ISO	RGD:733283	6480464	Sunitinib results in increased expression of ALCAM mRNA	CTD	PMID:31533062
Alcam	Rat	tamoxifen	affects expression	ISO	RGD:733283	6480464	Tamoxifen affects the expression of ALCAM mRNA	CTD	PMID:14699072
Alcam	Rat	temozolomide	decreases expression	ISO	RGD:733283	6480464	Temozolomide results in decreased expression of ALCAM mRNA	CTD	PMID:31758290
Alcam	Rat	terbufos	increases methylation	ISO	RGD:733283	6480464	terbufos results in increased methylation of ALCAM promoter	CTD	PMID:22847954
Alcam	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of ALCAM mRNA	CTD	PMID:21515302
Alcam	Rat	tetrachloromethane	affects expression	ISO	RGD:733284	6480464	Carbon Tetrachloride affects the expression of ALCAM mRNA	CTD	PMID:17484886
Alcam	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of ALCAM mRNA	CTD	PMID:31150632
Alcam	Rat	tetrachloromethane	multiple interactions	ISO	RGD:733284	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ALCAM mRNA	CTD	PMID:30517762
Alcam	Rat	tetrachloromethane	increases expression	ISO	RGD:733284	6480464	Carbon Tetrachloride results in increased expression of ALCAM mRNA	CTD	PMID:27339419\|PMID:31919559
Alcam	Rat	thapsigargin	increases expression	ISO	RGD:733283	6480464	Thapsigargin results in increased expression of ALCAM mRNA	CTD	PMID:22378314
Alcam	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of ALCAM mRNA	CTD	PMID:23411599\|PMID:34492290
Alcam	Rat	titanium dioxide	decreases methylation	ISO	RGD:733284	6480464	titanium dioxide results in decreased methylation of ALCAM promoter	CTD	PMID:35295148
Alcam	Rat	toluene	increases expression	EXP		6480464	Toluene results in increased expression of ALCAM mRNA	CTD	PMID:22967744
Alcam	Rat	topotecan	increases expression	EXP		6480464	Topotecan results in increased expression of ALCAM mRNA	CTD	PMID:25729387
Alcam	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of ALCAM mRNA	CTD	PMID:19448997\|PMID:33387578
Alcam	Rat	trichostatin A	increases expression	ISO	RGD:733283	6480464	trichostatin A results in increased expression of ALCAM mRNA	CTD	PMID:24935251\|PMID:26272509
Alcam	Rat	trichostatin A	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Alcam	Rat	trimellitic anhydride	increases expression	ISO	RGD:733284	6480464	trimellitic anhydride results in increased expression of ALCAM mRNA	CTD	PMID:19042947
Alcam	Rat	triphenyl phosphate	increases expression	EXP		6480464	triphenyl phosphate results in increased expression of ALCAM mRNA	CTD	PMID:30589522
Alcam	Rat	troglitazone	decreases expression	ISO	RGD:733284	6480464	troglitazone results in decreased expression of ALCAM mRNA	CTD	PMID:28973697
Alcam	Rat	valproic acid	affects expression	ISO	RGD:733283	6480464	Valproic Acid affects the expression of ALCAM mRNA	CTD	PMID:25979313
Alcam	Rat	valproic acid	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Alcam	Rat	valproic acid	increases expression	ISO	RGD:733283	6480464	Valproic Acid results in increased expression of ALCAM mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369
Alcam	Rat	venlafaxine hydrochloride	increases expression	EXP		6480464	Venlafaxine Hydrochloride results in increased expression of ALCAM mRNA	CTD	PMID:25423262
Alcam	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of ALCAM mRNA	CTD	PMID:23034163\|PMID:23555832
Alcam	Rat	vorinostat	increases expression	ISO	RGD:733283	6480464	vorinostat results in increased expression of ALCAM mRNA	CTD	PMID:26272509\|PMID:27188386
Alcam	Rat	vorinostat	multiple interactions	ISO	RGD:733283	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Alcam	Rat	Y-27632	decreases expression	ISO	RGD:733283	6480464	Y 27632 results in decreased expression of ALCAM mRNA	CTD	PMID:35388712

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alcam	Rat	adaptive immune response	involved_in	IEA	UniProtKB-KW:KW-1064	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alcam	Rat	axon extension involved in axon guidance	involved_in	ISS	UniProtKB:P42292	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	axon guidance	acts_upstream_of_or_within	ISO	RGD:733284	1624291	MGI:3056579 PMID:15345243	RGD	PMID:15345243
Alcam	Rat	axon guidance	acts_upstream_of_or_within	IEA	UniProtKB:Q61490\|ensembl:ENSMUSP00000023312	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	cell adhesion	involved_in	ISS	UniProtKB:P42292	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	cell adhesion	involved_in	IBA	PANTHER:PTN002633324\|UniProtKB:P42292\|UniProtKB:Q13740	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Alcam	Rat	cell adhesion	involved_in	IEA	UniProtKB-KW:KW-0130	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alcam	Rat	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	involved_in	IEA	UniProtKB:Q13740\|ensembl:ENSP00000305988	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	involved_in	ISO	RGD:733283	1624291	PMID:16352806	RGD	PMID:16352806
Alcam	Rat	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	involved_in	ISS	UniProtKB:Q13740	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alcam	Rat	motor neuron axon guidance	acts_upstream_of_or_within	ISO	RGD:733284	1624291	MGI:3056579 PMID:15345243	RGD	PMID:15345243
Alcam	Rat	motor neuron axon guidance	acts_upstream_of_or_within	IEA	UniProtKB:Q61490\|ensembl:ENSMUSP00000023312	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	neuron projection extension	involved_in	ISS	UniProtKB:P42292	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	retinal ganglion cell axon guidance	involved_in	ISS	UniProtKB:P42292	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alcam	Rat	axon	located_in	ISS	UniProtKB:P42292	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	axon	located_in	IEA	UniProtKB:Q61490\|ensembl:ENSMUSP00000023312	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	axon	located_in	ISO	RGD:733284	1624291	PMID:16267219	RGD	PMID:16267219
Alcam	Rat	axon	located_in	IEA	UniProtKB-SubCell:SL-0279	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Alcam	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alcam	Rat	dendrite	located_in	IEA	UniProtKB-SubCell:SL-0283	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Alcam	Rat	external side of plasma membrane	located_in	IEA	UniProtKB:Q61490\|ensembl:ENSMUSP00000023312	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	external side of plasma membrane	located_in	ISO	RGD:733284	1624291	PMID:9209500	RGD	PMID:9209500
Alcam	Rat	immunological synapse	located_in	ISS	UniProtKB:Q13740	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	immunological synapse	located_in	ISO	RGD:733283	1624291	PMID:15294938	RGD	PMID:15294938
Alcam	Rat	immunological synapse	located_in	IEA	UniProtKB:Q13740\|ensembl:ENSP00000305988	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alcam	Rat	neuronal cell body	located_in	IEA	UniProtKB:Q61490\|ensembl:ENSMUSP00000023312	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	neuronal cell body	located_in	ISO	RGD:733284	1624291	PMID:16267219	RGD	PMID:16267219
Alcam	Rat	plasma membrane	located_in	ISS	UniProtKB:Q13740	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	plasma membrane	located_in	IEA	UniProtKB:Q13740\|ensembl:ENSP00000305988	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Alcam	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Alcam	Rat	plasma membrane	is_active_in	IBA	MGI:1313266\|MGI:1929940\|PANTHER:PTN000944422\|RGD:69258\|UniProtKB:P42292\|UniProtKB:P43121\|UniProtKB:P50895\|UniProtKB:Q13740\|UniProtKB:Q15109	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Alcam	Rat	plasma membrane	located_in	ISO	RGD:733283	1624291	PMID:15294938	RGD	PMID:15294938
Alcam	Rat	plasma membrane	located_in	ISS	UniProtKB:P42292	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	T cell receptor complex	located_in	ISS	UniProtKB:Q13740	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Alcam	Rat	T cell receptor complex	located_in	IEA	UniProtKB:Q13740\|ensembl:ENSP00000305988	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	T cell receptor complex	located_in	ISO	RGD:733283	1624291	PMID:15294938	RGD	PMID:15294938

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alcam	Rat	identical protein binding	enables	IEA	UniProtKB:Q13740\|ensembl:ENSP00000305988	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Alcam	Rat	identical protein binding	enables	ISO	RGD:733283	1624291	UniProtKB:Q13740 PMID:26146185	RGD	PMID:26146185
Alcam	Rat	protein binding	enables	ISO	RGD:733283	1624291	UniProtKB:P09382\|UniProtKB:P17931\|UniProtKB:P30203 PMID:24945728, PMID:26146185, PMID:33961781	RGD	PMID:24945728\|PMID:26146185\|PMID:33961781
Alcam	Rat	protein binding	enables	ISO	RGD:733284	1624291	PR:Q61003 PMID:9209500	RGD	PMID:9209500

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

basal cell carcinoma (ISO)

carcinoma (ISO)

COVID-19 (ISO)

Experimental Mammary Neoplasms (IEP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-bromohexadecanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzoates (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloropicrin (ISO)

chlorpyrifos (EXP)

clobetasol (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

coumestrol (ISO)

curcumin (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

DDT (EXP)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP,ISO)

diuron (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

fonofos (ISO)

fucoxanthin (ISO)

fumonisin B1 (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

heptachlor (EXP)

inulin (ISO)

isotretinoin (ISO)

ivermectin (ISO)

lead diacetate (ISO)

lead(0) (ISO)

medroxyprogesterone acetate (ISO)

mercury dibromide (ISO)

methidathion (ISO)

methimazole (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

miconazole (ISO)

mitomycin C (ISO)

Muraglitazar (EXP)

N(gamma)-nitro-L-arginine methyl ester (ISO)

N-acetyl-1,4-benzoquinone imine (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-nitrosodiethylamine (ISO)

nickel sulfate (ISO)

nimesulide (EXP)

okadaic acid (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (EXP,ISO)

progesterone (ISO)

propiconazole (ISO)

protein kinase inhibitor (ISO)

raloxifene (ISO)

resveratrol (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

terbufos (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP)

troglitazone (ISO)

valproic acid (ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

vorinostat (ISO)

Y-27632 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

axon extension involved in axon guidance (ISS)

axon guidance (IEA,ISO)

cell adhesion (IBA,IEA,ISS)

heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules (IEA,ISO,ISS)

immune system process (IEA)

motor neuron axon guidance (IEA,ISO)

neuron projection extension (ISS)

retinal ganglion cell axon guidance (ISS)

Cellular Component

axon (IEA,ISO,ISS)

cell projection (IEA)

dendrite (IEA)

external side of plasma membrane (IEA,ISO)

immunological synapse (IEA,ISO,ISS)

membrane (IEA)

neuronal cell body (IEA,ISO)

plasma membrane (IBA,IEA,ISO,ISS)

T cell receptor complex (IEA,ISO,ISS)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Trisomy 10p due to t(5;10)(p15;p11) segregating in a large sibship.	Back E, etal., Hum Genet 1978 Feb 23;41(1):11-7.
2.	Mesenchymal stem cell surface antigen SB-10 corresponds to activated leukocyte cell adhesion molecule and is involved in osteogenic differentiation.	Bruder SP, etal., J Bone Miner Res 1998 Apr;13(4):655-63.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Cloning and characterization of HB2, a candidate high density lipoprotein receptor. Sequence homology with members of the immunoglobulin superfamily of membrane proteins.	Matsumoto A, etal., J Biol Chem 1997 Jul 4;272(27):16778-82.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.	Shan L, etal., Toxicol Pathol. 2005;33(7):768-75.
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8004458	PMID:9209500	PMID:15294938	PMID:15345243	PMID:15489334	PMID:16267219	PMID:16352806	PMID:16650408	PMID:19056867	PMID:19481784	PMID:20458337	PMID:21423176
PMID:22243278	PMID:26146185	PMID:28720382	PMID:38717494

Genomics

Comparative Map Data

Alcam
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	61,804,932 - 62,005,250 (+)	NCBI		GRCr8
mRatBN7.2	11	48,336,123 - 48,536,296 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	48,336,169 - 48,537,954 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	57,110,123 - 57,309,926 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	49,771,802 - 49,971,585 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	48,895,907 - 49,095,677 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	50,780,735 - 50,985,083 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	50,781,127 - 50,985,083 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	53,964,563 - 54,165,636 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	49,424,243 - 49,630,071 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	49,481,831 - 49,687,660 (+)	NCBI
Celera	11	48,024,575 - 48,218,199 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

ALCAM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	105,366,909 - 105,576,900 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	105,366,909 - 105,576,900 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	105,085,753 - 105,295,744 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	106,568,403 - 106,778,434 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	106,568,879 - 106,776,709	NCBI
Celera	3	103,484,109 - 103,694,111 (+)	NCBI		Celera
Cytogenetic Map	3	q13.11	NCBI
HuRef	3	102,460,407 - 102,670,632 (+)	NCBI		HuRef
CHM1_1	3	105,048,389 - 105,258,778 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	108,084,937 - 108,294,916 (+)	NCBI		T2T-CHM13v2.0

Alcam
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	52,069,359 - 52,273,444 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	52,069,359 - 52,274,437 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	52,248,996 - 52,453,081 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	52,248,996 - 52,454,074 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	52,249,109 - 52,453,110 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	52,170,261 - 52,373,422 (-)	NCBI		MGSCv36	mm8
Celera	16	52,580,657 - 52,784,804 (-)	NCBI		Celera
Cytogenetic Map	16	B5	NCBI
cM Map	16	32.88	NCBI

Alcam
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	6,494,124 - 6,545,963 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955427	6,494,657 - 6,544,668 (+)	NCBI	ChiLan1.0	ChiLan1.0

ALCAM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	103,319,297 - 103,529,920 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	103,325,067 - 103,534,696 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	102,468,354 - 102,677,932 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	109,407,296 - 109,616,518 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	109,407,992 - 109,616,518 (+)	Ensembl	panpan1.1		panPan2

ALCAM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	10,983,363 - 11,195,170 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	10,983,363 - 11,370,085 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	11,088,414 - 11,300,048 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	11,141,772 - 11,353,405 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	11,141,772 - 11,353,405 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	11,011,197 - 11,222,028 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	11,078,031 - 11,289,490 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	11,486,320 - 11,697,980 (+)	NCBI		UU_Cfam_GSD_1.0

Alcam
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	145,582,988 - 145,771,697 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936701	895,376 - 1,084,172 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936701	895,414 - 1,084,155 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALCAM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	153,794,993 - 153,998,208 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	153,794,991 - 153,998,241 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	162,988,454 - 163,045,771 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ALCAM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	75,261,104 - 75,475,201 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	75,260,970 - 75,321,082 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	91,034,797 - 91,244,770 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Alcam
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	44,091,769 - 44,280,621 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	44,092,505 - 44,280,022 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Alcam
796 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	125
Count of miRNA genes:	87
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000002738
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat

Markers in Region

D11Got122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	48,515,156 - 48,515,439 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	50,963,785 - 50,964,067	NCBI	Rnor6.0
Rnor_5.0	11	54,144,338 - 54,144,620	UniSTS	Rnor5.0
RGSC_v3.4	11	49,608,932 - 49,609,214	UniSTS	RGSC3.4
Celera	11	48,197,060 - 48,197,342	UniSTS
Cytogenetic Map	11	q21	UniSTS

BE119309

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	48,524,043 - 48,524,252 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	50,972,672 - 50,972,880	NCBI	Rnor6.0
Rnor_5.0	11	54,153,225 - 54,153,433	UniSTS	Rnor5.0
RGSC_v3.4	11	49,617,819 - 49,618,027	UniSTS	RGSC3.4
Celera	11	48,205,947 - 48,206,155	UniSTS
Cytogenetic Map	11	q21	UniSTS

BE116234

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	48,518,246 - 48,518,443 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	50,966,875 - 50,967,071	NCBI	Rnor6.0
Rnor_5.0	11	54,147,428 - 54,147,624	UniSTS	Rnor5.0
RGSC_v3.4	11	49,612,022 - 49,612,218	UniSTS	RGSC3.4
Celera	11	48,200,150 - 48,200,346	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH138841

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	48,379,167 - 48,379,335 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	50,829,414 - 50,829,581	NCBI	Rnor6.0
Rnor_5.0	11	54,011,065 - 54,011,232	UniSTS	Rnor5.0
RGSC_v3.4	11	49,468,285 - 49,468,452	UniSTS	RGSC3.4
Celera	11	48,067,231 - 48,067,398	UniSTS
RH 3.4 Map	15	185.3	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH139064

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	48,535,717 - 48,535,887 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	50,984,505 - 50,984,674	NCBI	Rnor6.0
Rnor_5.0	11	54,165,058 - 54,165,227	UniSTS	Rnor5.0
RGSC_v3.4	11	49,629,493 - 49,629,662	UniSTS	RGSC3.4
Celera	11	48,217,621 - 48,217,790	UniSTS
Cytogenetic Map	11	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001431413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_031753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB008538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y13240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y13241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002738 ⟹ ENSRNOP00000002738

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	48,336,169 - 48,537,016 (+)	Ensembl
Rnor_6.0 Ensembl	11	50,781,127 - 50,985,083 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104562 ⟹ ENSRNOP00000080494

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	48,336,169 - 48,537,954 (+)	Ensembl

RefSeq Acc Id:

NM_031753 ⟹ NP_113941

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	61,805,457 - 62,005,250 (+)	NCBI
mRatBN7.2	11	48,336,515 - 48,536,296 (+)	NCBI
Rnor_6.0	11	50,781,127 - 50,985,083 (+)	NCBI
Rnor_5.0	11	53,964,563 - 54,165,636 (+)	NCBI
RGSC_v3.4	11	49,424,243 - 49,630,071 (+)	RGD
Celera	11	48,024,575 - 48,218,199 (+)	RGD

Sequence:

show sequence

GTGGAGGAAAGTTGCGTGTGGCACAGACCCGACGGCGCAGCGCCACAGCGACCGGGGGATCGTG
TGTCTTGGAAAAAAAAGTCGCTGTCCCCCTAAGCGAGACCCACAAGCGAGCGGGCCCCGTGGGC
CCGGGGACGACGCCCCCTCTGCGGCGTGGACTTTGTCGGTGGCCTTCTAGGAGGAGGAATATGG
CATCTAAAGGGTCCCCTTCTTGCCGTCTGGTTTTCTGCCTCTTGATCTCCGCCGCGGTCCTCAG
ACCAGGCCTCGGATGGTACACTGTCAACTCAGCATACGGAGATACCATTGTCATGCCTTGCAGA
CTGGATGTACCTCAGAACCTCATGTTTGGCAAATGGAAATATGAAAAGCCTGATGGGTCCCCAG
TATTTATTGCATTCAGATCTTCTACAAAGAAAAGTGTGCAGTATGATGATGTACCAGAGTACAA
GGACAGACTGAGCCTCTCAGAAAACTACACTCTGTCTATCAACAATGCAAAGATCAGTGACGAA
AAGAGATTTGTGTGCATGCTAGTGACCGAGGACAACGTGTTTGAGGCACCTACCCTGGTCAAGG
TGTTCAAGCAACCATCTAAACCTGAAATTGTAAACAGAGCAGCGTTTCTTGAAACAGAGCAGCT
AAAAAAGTTAGGTGACTGCATTTCAAGAGACAGTTACCCAGACGGCAACATCACGTGGTATAGG
AATGGGAAAGTGCTACAGCCTGTTGATGGAGAGGTGTCCATACTTTTTAAAAAGGAAATTGATC
CAGGTACTCAGTTGTATACCATGACTTCCTCCTTGGAGTACAAGACAACCAAGTCTGACATACA
AATGCCATTCACCTGTTCTGTGACATATTATGGACCTTCGGGCCAGAAAACAATTTATTCTGAA
CAAGCAATCTTTGATATTTACTATCCTACAGAGCAGGTGACAATACAAGTACTGCCACCAAAAA
ATGCCATCAAAGAAGGGGACAACATCACCCTTCAGTGCTTGGGGAATGGCAACCCACCTCCTGA
GGAGTTCATGTTTTACTTACCAGGGCAGGCTGAAGGCATAAGAAGCTCAAACACTTACACACTG
ACAGACGTGAGACGCAATGCCACCGGGGACTACAAATGTTCTCTCATCGACCAAAGAAACATGG
CAGCTTCAACAACCATCACTGTTCACTACTTGGATTTATCCTTAAACCCAAGTGGGGAAGTGAC
CAAGCAGATCGGTGATACCCTGCCTGTGTCTTGCACAATATCTGCAAGTAGGAATGCAACTGTG
GTGTGGATGAAGGATAACATCAGGCTCCGATCTAGTCCATCCTTTTCTAGTCTTCATTATCAGG
ATGCTGGGAACTATGTCTGTGAAACTGCTCTTCAGGAGGTTGAGGGACTGAAGAAAAGGGAGTC
GCTGACCCTCATCGTAGAAGGAAAACCTCAAATCAAAATGACAAAGAAAACTGATCCCAGTGGA
CTGTCTAAGACTATAATCTGCCATGTGGAAGGGTTTCCAAAGCCAGCTATACAGTGGACCATTA
CCGGCAGTGGAAGCGTCATAAACCAAACAGAGGAGTCTCCTTATATTAATGGCAGGTATTATAG
TAAAATTATCATTTCCCCTGAGGAGAATGTTACATTAACTTGCACAGCAGAAAACCAACTGGAG
AGAACAGTAAACTCCCTGAATGTCTCTGCGATAAGTATTCCAGAACACGATGAGGCAGACGATA
TAAGTGATGAAAACAGAGAAAAGGTGAATGACCAGGCCAAACTAATTGTGGGCATTGTGGTTGG
TCTCCTCCTCGCCGCCCTCGTCGCCGGTGTCGTCTACTGGCTGTACATGAAGAAATCGAAAACT
GCATCAAAACATGTAAACAAGGACCTTGGTAATATGGAGGAGAATAAAAAGCTAGAAGAAAACA
ATCACAAAACAGAAGCCTAAGAGAGGAGTTGTTTAGATGTCCTGAGAAAAAAACATATAAAGAA
ATTGAAGCATGAACGTGATTGTATTTAAGACATATACAAAGACAATGACAGCAATTCATGGTTC
AAGTATTAAGATGTTCATCCTACTAAGCTGTCCTGGGATCTTAGAGAATTATCTCAAGTAAAAC
AATGAAATAAAGTTATAAAATTACAACAAGATTTGGCAGCCATGATAATAGGTCATATGTTGTA
TTTCGTTTGATTTTCCTTTTCTGTAAATGTCTGCACTGAGGATTTCTTTCAGTTTGCCTTTTAT
GTAAATTTTTTACGTAGCTATTTTTATACACTGTAAGCTTTGTTCTGGGAGTGGCTGTTAATTG
GATGTACAATGTAATGTTTATTTCAATTGTTTATATGGATAGTCTGAGCAGGTGCGGTTCTGAT
TCTGATTGCTATCAGTAATGCCCCAAACTTTCTTGTGAGGATCTGAAACCCAAAGGTGGCAGTT
ATGAGATTGGGACATGGATCTTGCCCAATCAGAAGCTGGTTTTTTTTTTAAAAAAAAAAACCTG
GAGAGTCAGGAGCACCATAAGATATGATGGTCTCTATGTGCCAACGGGTTCCCCGAAGCGGGTC
ACAAACACATACGGCAACACCACATGTGAATGATACTTTTAAACTGACAATTTCGTCTTCTCTG
AAAAAAGACATACACAGAGTTTGTATAACACTTTACTTAACGACACTTGCTAGAAAATTACATT
CTGTTTTTAAAAAAAATAAGGAAAATGTAAAGAAGAATATCTAATATGTCAGAGAAAGTTGGAA
ACAAATCACAGCTCGCATCCCCATAGTCGCAGATCACGATGTAAATCACTGTAATTAAAATTGG
TGTTAAATCCTTTGGGTTATCCACTGCCTTAAAATGACACTTATTTCCTT

hide sequence

RefSeq Acc Id:

XM_063270772 ⟹ XP_063126842

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	61,804,932 - 62,002,469 (+)	NCBI

RefSeq Acc Id:

XM_063270773 ⟹ XP_063126843

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	61,804,932 - 62,002,469 (+)	NCBI

RefSeq Acc Id:

XM_063270774 ⟹ XP_063126844

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	61,804,932 - 61,989,800 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001418342	(Get FASTA)	NCBI Sequence Viewer
	NP_001418343	(Get FASTA)	NCBI Sequence Viewer
	NP_113941	(Get FASTA)	NCBI Sequence Viewer
	XP_063126842	(Get FASTA)	NCBI Sequence Viewer
	XP_063126843	(Get FASTA)	NCBI Sequence Viewer
	XP_063126844	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61970	(Get FASTA)	NCBI Sequence Viewer
	BAA23279	(Get FASTA)	NCBI Sequence Viewer
	CAA73692	(Get FASTA)	NCBI Sequence Viewer
	CAA73693	(Get FASTA)	NCBI Sequence Viewer
	EDM11076	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002738
	ENSRNOP00000080494
GenBank Protein	O35112	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113941 ⟸ NM_031753
- Peptide Label:	precursor
- UniProtKB:	O55172 (UniProtKB/Swiss-Prot), O35112 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASKGSPSCRLVFCLLISAAVLRPGLGWYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEKPDGS PVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSINNAKISDEKRFVCMLVTEDNVFEAPTLV KVFKQPSKPEIVNRAAFLETEQLKKLGDCISRDSYPDGNITWYRNGKVLQPVDGEVSILFKKEI DPGTQLYTMTSSLEYKTTKSDIQMPFTCSVTYYGPSGQKTIYSEQAIFDIYYPTEQVTIQVLPP KNAIKEGDNITLQCLGNGNPPPEEFMFYLPGQAEGIRSSNTYTLTDVRRNATGDYKCSLIDQRN MAASTTITVHYLDLSLNPSGEVTKQIGDTLPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHY QDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIQWT ITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEAD DISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEE NNHKTEA hide sequence

Ensembl Acc Id:

ENSRNOP00000002738 ⟸ ENSRNOT00000002738

Ensembl Acc Id:

ENSRNOP00000080494 ⟸ ENSRNOT00000104562

RefSeq Acc Id:	XP_063126842 ⟸ XM_063270772
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063126843 ⟸ XM_063270773
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063126844 ⟸ XM_063270774
- Peptide Label:	isoform X3

Protein Domains

Ig-like Ig-like C2-type Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35112-F1-model_v2	AlphaFold	O35112	1-583	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619972	AgrOrtholog
BioCyc Gene	G2FUF-21474	BioCyc
Ensembl Genes	ENSRNOG00000001989	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000002738	ENTREZGENE
	ENSRNOT00000104562	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5621856	IMAGE-MGC_LOAD
InterPro	CD80_C2-set	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Surface_Rcpt/Adhesion_Mol	UniProtKB/Swiss-Prot
KEGG Report	rno:79559	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72388	IMAGE-MGC_LOAD
NCBI Gene	79559	ENTREZGENE
PANTHER	CELL SURFACE GLYCOPROTEIN MUC18-RELATED	UniProtKB/Swiss-Prot
	PTHR11973:SF2	UniProtKB/Swiss-Prot
Pfam	C2-set_2	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
PhenoGen	Alcam	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001989	RatGTEx
SMART	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZQS5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UHD3	ENTREZGENE, UniProtKB/TrEMBL
	A6IQS3	ENTREZGENE, UniProtKB/TrEMBL
	CD166_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	O55172	ENTREZGENE
UniProt Secondary	O55172	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Alcam	activated leukocyte cell adhesion molecule			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Alcam	activated leukocyte cell adhesion molecule			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD